Gene Details:

  • Gene ID: EcC054699.100
  • Gene Family: NF-X1 Family
  • Description: NF-X1 Family protein
  • Species: Eucalyptus camaldulensis
  • Source: NF-YA family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_018731962.1  — PREDICTED: nuclear transcription factor Y subunit A-3 isoform X2
  • TrEMBL:  A0A059BUY4  — A0A059BUY4_EUCGR; Uncharacterized protein
  • STRING:  XP_010062677.1  — (Eucalyptus grandis)

Gene Ontology:

  • GO:0000045  — Biological Process — autophagosome assembly
  • GO:0000290  — Biological Process — deadenylation-dependent decapping of nuclear-transcribed mRNA
  • GO:0006090  — Biological Process — pyruvate metabolic process
  • GO:0006352  — Biological Process — DNA-templated transcription, initiation
  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0006468  — Biological Process — protein phosphorylation
  • GO:0015979  — Biological Process — photosynthesis
  • GO:0016567  — Biological Process — protein ubiquitination
  • GO:0031347  — Biological Process — regulation of defense response
  • GO:0045087  — Biological Process — innate immune response
  • GO:0055114  — Biological Process — oxidation-reduction process
  • GO:0000932  — Cellular Component — cytoplasmic mRNA processing body
  • GO:0005669  — Cellular Component — transcription factor TFIID complex
  • GO:0009654  — Cellular Component — photosystem II oxygen evolving complex
  • GO:0045254  — Cellular Component — pyruvate dehydrogenase complex
  • GO:0003677  — Molecular Function — DNA binding
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0003899  — Molecular Function — DNA-directed RNA polymerase activity
  • GO:0004672  — Molecular Function — protein kinase activity
  • GO:0004742  — Molecular Function — dihydrolipoyllysine-residue acetyltransferase activity
  • GO:0004842  — Molecular Function — ubiquitin-protein transferase activity
  • GO:0005524  — Molecular Function — ATP binding
  • GO:0005525  — Molecular Function — GTP binding
  • GO:0008270  — Molecular Function — zinc ion binding
  • GO:0016491  — Molecular Function — oxidoreductase activity
  • GO:0016810  — Molecular Function — hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
  • GO:0046982  — Molecular Function — protein heterodimerization activity

Family Introduction:

  • NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
  • NF-YA proteins are characterized by the presence of Gln(Q)- and Ser/Thr(S/T)-rich NH2 termini, a subunit interaction domain (NF-YB/NF-YC interaction), and a DNA-binding domain (Olesen and Guarente, 1990; Maity and de Crombrugghe, 1992; Xing et al., 1993, 1994). The protein interaction and DNA binding domains are well conserved between plant and other eukaryote lineages.

Literature:

Sequences:

CDS Sequence:
  • >EcC054699.100|Eucalyptus_camaldulensis|NF-YA|EcC054699.100
    ATGTCTTGGTATGTCGGTAGCAGCCCATCTAGAGAGGCTTCCACCATATCACAGTTTGGACTTGTGCCAATGCCAAAAGGTTCAAGCATAAAGATGGGAGTTCCACTGCAACATTCTAGTGGTATCAAACAATTGAATGTTCATTTTCAAGAGCGGGACTTGTGTTCTACTCAATCAACCAGTCAATCACTCAGTGAAGTGCCTAATATAGGAGGAAGTACTGACTGTAGCCAAGCCTCAGTTTTAGAACAGACAGAACATGGTGAAACTGAAGGGCAATCAGTGAGAGGACAAGCAAAATCAGCCTTGTCAATGGGAACTCAGGATTTAGTCTTCCAACCTTTAGAGGTGTGCATCCCACTCCACTATGCTGAACCATCCTTGGGTGGTTTTATGCCCGCTGCTTATAGGCCACAGGCTATGATCTCTTACCCTCAAATGGCAGGAACGATACCCTCTCGACTGCCTCTGCCCTTTGATACGACACAAGAAGAACCGGTCTATGTAAATGCAAAACAGTATCATGGTATTCTCCGGAGAAGACAGTACCGCGCAAAGCTCGGGGCTGAAAACAAGCTCATCAAGGATAGAAAGCCTTACCTTCACGAATCTCGGCATCATCATGCAGTAAGAAGGCCAAGGGGATCCGGTGGGCGTTTTCTCTCAAAGGATCAGAAAGAATCAAAACTTACCTCCCTTAATGATGAATCAAACGTCAAAAGCACCGCAAGGGTGTCTTCAGCCATCGATTTACCGAATTCAGAGGTTTTTCAGCTGAAAGATCACAGAGACACCGGCTCCACCACCTCTTGCTCCAAAACGACTCAAACCACCACCAGCAGTGACGCCATCCCGGTGTCAAAATTCAGGTTCTTTGGTCAACCTTGGCATGTGATGACCACGTGTGATCCTTCTTGTGACGTTCGTTATAGTGGGGATATTCGCCATCTTTCTCTGCCAGGTGAAAGATGA
Protein Sequence:
  • >EcC054699.100|Eucalyptus_camaldulensis|NF-YA|EcC054699.100
    MSWYVGSSPSREASTISQFGLVPMPKGSSIKMGVPLQHSSGIKQLNVHFQERDLCSTQSTSQSLSEVPNIGGSTDCSQASVLEQTEHGETEGQSVRGQAKSALSMGTQDLVFQPLEVCIPLHYAEPSLGGFMPAAYRPQAMISYPQMAGTIPSRLPLPFDTTQEEPVYVNAKQYHGILRRRQYRAKLGAENKLIKDRKPYLHESRHHHAVRRPRGSGGRFLSKDQKESKLTSLNDESNVKSTARVSSAIDLPNSEVFQLKDHRDTGSTTSCSKTTQTTTSSDAIPVSKFRFFGQPWHVMTTCDPSCDVRYSGDIRHLSLPGER