Gene Details:
- Gene ID: Cagra.1508s0155.1.p
- Gene Family: NF-X1 Family
- Description: NF-X1 Family protein
- Species: Capsella grandiflora
- Source: NF-YA family gene from PlantTFDB
Protein Features:
- SMART: SM00521
- PROSITE profile: PS51152
- Pfam: PF02045
- PRINTS: PR00616
- PROSITE pattern: PS00686
- InterPro: IPR001289 IPR018362
Annotation Proteins:
- Refseq: XP_006305656.1 — nuclear transcription factor Y subunit A-7 isoform X2
- Swissprot: Q84JP1 — NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
- TrEMBL: R0I898 — R0I898_9BRAS; Uncharacterized protein
- STRING: Cagra.1508s0155.1.p — (Capsella grandiflora)
Gene Ontology:
- GO:0045892 — Biological Process — negative regulation of transcription, DNA-templated
- GO:0016602 — Cellular Component — CCAAT-binding factor complex
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction:
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- NF-YA proteins are characterized by the presence of Gln(Q)- and Ser/Thr(S/T)-rich NH2 termini, a subunit interaction domain (NF-YB/NF-YC interaction), and a DNA-binding domain (Olesen and Guarente, 1990; Maity and de Crombrugghe, 1992; Xing et al., 1993, 1994). The protein interaction and DNA binding domains are well conserved between plant and other eukaryote lineages.
Literature:
- Tissue-specific expression patterns of Arabidopsis NF-Y transcription factors suggest potential for extensive combinatorial complexity. DOI: 10.1104/pp.108.130591 ; PMID: 19019982
Sequences:
CDS Sequence:
- >Cagra.1508s0155.1.p|Capsella_grandiflora|NF-YA|Cagra.1508s0155.1.p
ATGACTTCAATCCATCAGCTCTCTGAAAATATTGAAAGTCATGAGAAACAAGAACAGAGAGATTCTCATTTCCAACCACCAACTCCTCCCGGAAGACATTATGAATCAATAGCTACAAGTTTAGTCTACTCAGAGCCTGTTCCTCACCCGGGGAGTACACATTCTATGGCACCTGGACAATACCCGTATCCTGATCCGTACTACAGAAGCATCTTTGCACCGCCTCCACAACCCTATGCTGGGGTACATATACAGTTGATGGGAATGCAGCAACAAGGTGTTCCTTTGCCATCTGATGCAGTCGAGGAACCTGTTTTTGTAAACGCAAAGCAATACCATGGAATACTGAGGCGAAGGCAATCTAGAGCAAAACTTGAATCGCAGAATAAAGTCATCAAGTCACGTAAGCCATATTTGCATGAATCTCGGCATTTGCATGCGATAAGACGACCAAGAGGATGTGGCGGCCGGTTTCTCAATGTGAAGAAGGACGACGAGCATCACGAAGACAGTCATGAAGATAATTCAAACCTTAGCTCTGGTAAATCCGCTATGGCTGCTTCTAGTGGTGGTACATCTTGA
Protein Sequence:
- >Cagra.1508s0155.1.p|Capsella_grandiflora|NF-YA|Cagra.1508s0155.1.p
MTSIHQLSENIESHEKQEQRDSHFQPPTPPGRHYESIATSLVYSEPVPHPGSTHSMAPGQYPYPDPYYRSIFAPPPQPYAGVHIQLMGMQQQGVPLPSDAVEEPVFVNAKQYHGILRRRQSRAKLESQNKVIKSRKPYLHESRHLHAIRRPRGCGGRFLNVKKDDEHHEDSHEDNSNLSSGKSAMAASSGGTS*