Information report for Ahy009687
Gene Details
Functional Annotation
- Refseq: XP_015972671.1 — nuclear transcription factor Y subunit A-1
- Refseq: XP_015972734.1 — nuclear transcription factor Y subunit A-1
- Refseq: XP_025690366.1 — nuclear transcription factor Y subunit A-1
- Refseq: XP_025690375.1 — nuclear transcription factor Y subunit A-1
- Swissprot: Q9LXV5 — NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
- TrEMBL: A0A445EW81 — A0A445EW81_ARAHY; Uncharacterized protein
- STRING: GLYMA18G07890.2 — (Glycine max)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0016602 — Cellular Component — CCAAT-binding factor complex
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- NF-YA proteins are characterized by the presence of Gln(Q)- and Ser/Thr(S/T)-rich NH2 termini, a subunit interaction domain (NF-YB/NF-YC interaction), and a DNA-binding domain (Olesen and Guarente, 1990; Maity and de Crombrugghe, 1992; Xing et al., 1993, 1994). The protein interaction and DNA binding domains are well conserved between plant and other eukaryote lineages.
Literature and News
Gene Resources
Homologs
- Cajanus cajan: C.cajan_19873
- Cicer arietinum: XP_012571278.1, XP_004500197.1, XP_004500196.1
- Glycine max: Glyma.18G071000.4.p, Glyma.18G071000.2.p, Glyma.18G071000.1.p, Glyma.18G071000, Glyma.08G335900.2.p, Glyma.08G335900.1.p, Glyma.08G335900, Glyma.18G071000.3.p
- Juglans regia: Jr14_19640
- Lotus japonicus: Lj6g3v0647470.1
- Medicago truncatula: Medtr3g061510.2, Medtr3g061510.1, Medtr3g061510
- Pyrus bretschneideri: Pbr017220.1
Sequences
CDS Sequence:
- >Ahy009687|Arachis_hypogaea|NF-YA|gnl|UG|Ahy#S58473152;PUT-171a-Arachis_hypogaea-2317
ATGCAGTCCAAGTCTGAAACTGCAAATCGACTGAGGTCGGATCCACATTCCTTTCAACCTAGTGGTGTTTGTTCTGAGCCTTGGTGGCATGGTGGTGGCTACAGTGCTATCCCTCAAGCAATGCCTGGTGCAAATGCATCCAATTCCTCCTCTCTTGAATGCCCTAATGGTGAATCAGAATCCAATGAGGAAGGTCAGTCCTTATCCAATAGTGGGATGAATGAGGAAGATGATGATGCTGCCAAGGATTCACAACCTGCCGATCCTAATCAATCAGGAAATTATGGACAAGAAAACCAAGGGATGCAGCATTCTGCACCTTCAATGCGCGAAGAAGGCCTCGCTCAGGCTCCACAGCTGGAACTCGTTGGTCATTCAATTGCATGTGCTACAAATCCTTATCAAGATCCGTACTATGGGGGCATGATGGCAGCTTATGGACCCCAGCAATTGGGATTCGCTCCTTTTATAGGAATGCCCCATGCCAGAATGCCATTGCCTCTTGAGATGGCACAAGAGCCTGTTTATGTGAATGCTAAGCAATACCAAGGAATTCTGAGGCGAAGACAGGCTCGAGCAAAAGCAGAACTTGAAAAGAAGCTAATAAAATCCAGAAAGCCATATCTTCATGAATCTCGGCATCAGCATGCTATGAGAAGGGCAAGGGGTACCGGAGGGCGTTTTGCAAAGAAATCTGAAGTTGAGGGCTCAAACAAGGGCAAGGAAAAGGATGGTTCAGGTCCAGTCCTGTCATCACAGTCAATCAGTTCATCTGGTTCTGAACCTTTGCCTTGCGATTCCAATCAAACATGGAACTCTCCCAATGTGCAACTAAATGCAAGGGGATCGAAAGTGCACGACAAATACGAAAATGGCAGTGGCTCCTACCACAGTCATAATGGTTTGCAATCTTATCATTTGCATTCTGGTGACAGAGTGGATGAAGGGGACTGTTCGGGTCAGCAACGGGGAAGCATCACCAACGAGCACGCATCGGCGAGGCGCCTTGCTATTCAGTAG
Protein Sequence:
- >Ahy009687|Arachis_hypogaea|NF-YA|gnl|UG|Ahy#S58473152;PUT-171a-Arachis_hypogaea-2317
MQSKSETANRLRSDPHSFQPSGVCSEPWWHGGGYSAIPQAMPGANASNSSSLECPNGESESNEEGQSLSNSGMNEEDDDAAKDSQPADPNQSGNYGQENQGMQHSAPSMREEGLAQAPQLELVGHSIACATNPYQDPYYGGMMAAYGPQQLGFAPFIGMPHARMPLPLEMAQEPVYVNAKQYQGILRRRQARAKAELEKKLIKSRKPYLHESRHQHAMRRARGTGGRFAKKSEVEGSNKGKEKDGSGPVLSSQSISSSGSEPLPCDSNQTWNSPNVQLNARGSKVHDKYENGSGSYHSHNGLQSYHLHSGDRVDEGDCSGQQRGSITNEHASARRLAIQ