Information report for 462878261
Gene Details
Functional Annotation
- Refseq: XP_004963231.1 — nuclear transcription factor Y subunit A-7
- TrEMBL: A0A3L6RBK9 — A0A3L6RBK9_PANMI; Nuclear transcription factor Y subunit A-7
- STRING: Pavir.J06031.1.p — (Panicum virgatum)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0016602 — Cellular Component — CCAAT-binding factor complex
- GO:0016602 — Cellular Component — CCAAT-binding factor complex
- GO:0016602 — Cellular Component — CCAAT-binding factor complex
- GO:0016602 — Cellular Component — CCAAT-binding factor complex
- GO:0003677 — Molecular Function — DNA binding
- GO:0003677 — Molecular Function — DNA binding
- GO:0003677 — Molecular Function — DNA binding
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- NF-YA proteins are characterized by the presence of Gln(Q)- and Ser/Thr(S/T)-rich NH2 termini, a subunit interaction domain (NF-YB/NF-YC interaction), and a DNA-binding domain (Olesen and Guarente, 1990; Maity and de Crombrugghe, 1992; Xing et al., 1993, 1994). The protein interaction and DNA binding domains are well conserved between plant and other eukaryote lineages.
Literature and News
Gene Resources
Homologs
- Panicum virgatum: Pavir.3NG282900.1.p, Pavir.3KG543700.1.p
- Setaria italica: Seita.3G394900.3.p, Seita.3G394900.2.p, Seita.3G394900.1.p
Sequences
CDS Sequence:
- >462878261|Eragrostis_tef|NF-YA|462878261
ATGACTTCCGTGGTCCAGAGTGTTTCAGGTGACCACAGAGCTGAGGATCAACATCAACAGAATAAGCAGAAGCAAGCTGAACCTGAGGACCAACAAGAAGCCTCAGTTACTAGTTCAGGTAGTCAAACAATGGTGGGCACACCATCAGCAGATTATGTGGCAGCCTATGCCCCTCATGACATGGCGCATGCAATGGGTCAATTTGCTTACCCAAATGTCGACCCATACTATGGAAGCCTATATGCAGCTTATGGTGGACAGCCAATGATGCATCCACCATTGGTCGGAATGCATCCGACTGGTTTGCCGTTACCTACTGATGCAATTGAAGAGCCTGTGTATGTAAATGCAAAGCAATACAATGCAATATTAAGGCGACGTCAGTCTCGGGCTAAAGCTGAATCTGAAAGGAAGCTTATCAAGGGCCGCAAGGTAAGTCTTTGTAATCCGCTTCACAGTGCCATGACATGGAATTCTAAATTAGCTGTTTGTGTCCATGATTCTGGAGCAAATAATCAAGTGAATTGTCGAATCTACCCTCCCTACTTCCGCTTGAAGATCGACCTGCCCCACGTTGTACTATAA
Protein Sequence:
- >462878261|Eragrostis_tef|NF-YA|462878261
MTSVVQSVSGDHRAEDQHQQNKQKQAEPEDQQEASVTSSGSQTMVGTPSADYVAAYAPHDMAHAMGQFAYPNVDPYYGSLYAAYGGQPMMHPPLVGMHPTGLPLPTDAIEEPVYVNAKQYNAILRRRQSRAKAESERKLIKGRKVSLCNPLHSAMTWNSKLAVCVHDSGANNQVNCRIYPPYFRLKIDLPHVVL