Gene Details:

  • Gene ID: Zmw_sc02503.1.g00120.1
  • Gene Family: NF-X1 Family
  • Description: NF-X1 Family protein
  • Species: Zoysia matrella
  • Source: NF-X1 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_004968270.1  — NF-X1-type zinc finger protein NFXL2
  • Swissprot:  Q9FFK8  — NFXL2_ARATH; NF-X1-type zinc finger protein NFXL2
  • TrEMBL:  A0A3L6SJT8  — A0A3L6SJT8_PANMI; NF-X1-type zinc finger protein NFXL2
  • STRING:  TRIUR3_19081-P1  — (Triticum urartu)

Family Introduction:

  • The human NF-X1 protein and homologous proteins in eukaryotes represent a class of transcription factors which are characterised by NF-X1 type zinc finger motifs. The Arabidopsis genome encodes two NF-X1 homologs, which we termed AtNFXL1 and AtNFXL2.
  • The Arabidopsis AtNFXL1 and AtNFXL2 proteins are characterized by NF-X1 type zinc fingers, which potentially mediate DNA binding, and PHD finger motifs, which potentially mediate protein interactions. The AtNFXL1 protein is part of a regulatory mechanism, which improves the physiological status of plants and supports growth and survival under stress.

Literature:

Sequences:

CDS Sequence:
  • >Zmw_sc02503.1.g00120.1|Zoysia_matrella|NF-X1|Zmw_sc02503.1.g00120.1
Protein Sequence:
  • >Zmw_sc02503.1.g00120.1|Zoysia_matrella|NF-X1|Zmw_sc02503.1.g00120.1
    MGETVGNAHFEVVALVHVGRKIIQECDAEAATCGSTCEKVLGCGRHRCPERCHRGPCNDTCRLVVTKSCRCGGLKKEVPCGTEKNQKPPKCSKKCNIPRLCRHKLECRVNARCSCNTLKQEWICQDVLKEYRKLGRDPKEVPKNQFGVGLLACGGDCIKKVKVPDSELHLRKSQVNKV