Gene Details:
- Gene ID: Traes_3DS_F9B6E4E1F.1
- Gene Family: NF-X1 Family
- Description: NF-X1 Family protein
- Species: Triticum aestivum
- Source: NF-X1 family gene from PlantTFDB
Protein Features:
- SuperFamily: SSF57850
- PROSITE profile: PS50016
- PROSITE pattern: PS01359
- PROSITE profile: PS50089
- SMART: SM00438
- Pfam: PF01422
- Pfam: PF01424
- Gene3D: G3DSA:3.30.70.330
- InterPro: IPR019787 IPR019786 IPR001841 IPR000967 IPR001374 IPR012677
Annotation Proteins:
- Refseq: XP_020188359.1 — NF-X1-type zinc finger protein NFXL2
- Swissprot: Q9FFK8 — NFXL2_ARATH; NF-X1-type zinc finger protein NFXL2
- TrEMBL: A0A453ECJ0 — A0A453ECJ0_AEGTS; Uncharacterized protein
- STRING: Traes_3DS_F9B6E4E1F.1 — (Triticum aestivum)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0008270 — Molecular Function — zinc ion binding
Family Introduction:
- The human NF-X1 protein and homologous proteins in eukaryotes represent a class of transcription factors which are characterised by NF-X1 type zinc finger motifs. The Arabidopsis genome encodes two NF-X1 homologs, which we termed AtNFXL1 and AtNFXL2.
- The Arabidopsis AtNFXL1 and AtNFXL2 proteins are characterized by NF-X1 type zinc fingers, which potentially mediate DNA binding, and PHD finger motifs, which potentially mediate protein interactions. The AtNFXL1 protein is part of a regulatory mechanism, which improves the physiological status of plants and supports growth and survival under stress.
Literature:
- The AtNFXL1 gene encodes a NF-X1 type zinc finger protein required for growth under salt stress. DOI: 10.1016/j.febslet.2006.07.079 ; PMID: 16905136
Sequences:
CDS Sequence:
- >Traes_3DS_F9B6E4E1F.1|Triticum_aestivum|NF-X1|Traes_3DS_F9B6E4E1F.1
GATTATCCAAGGTTGGAGTGTGATGTGGAGGCCGCGACATGTGGATCGACTTGTGAGAAGGTGCTTGGGTGCGGACGGCACAAGTGCCCCGAGCGGTGCCATCGTGGCCCGTGTGACGTGACCTGCCGGCTTGTGATAAAAAAGTCCTGCCGCTGTGGTGTTCTGAAGAAGGAGCTGCCTTGCCACCAAGACTTGACCTGCGAAAGGAAATGTCAGCGGTTTACGTGCCTGTGGACGCCACGC
Protein Sequence:
- >Traes_3DS_F9B6E4E1F.1|Triticum_aestivum|NF-X1|Traes_3DS_F9B6E4E1F.1
DYPRLECDVEAATCGSTCEKVLGCGRHKCPERCHRGPCDVTCRLVIKKSCRCGVLKKELPCHQDLTCERKCQRFTCLWTPR