Gene Details:

  • Gene ID: Traes_3DS_F9B6E4E1F.1
  • Gene Family: NF-X1 Family
  • Description: NF-X1 Family protein
  • Species: Triticum aestivum
  • Source: NF-X1 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_020188359.1  — NF-X1-type zinc finger protein NFXL2
  • Swissprot:  Q9FFK8  — NFXL2_ARATH; NF-X1-type zinc finger protein NFXL2
  • TrEMBL:  A0A453ECJ0  — A0A453ECJ0_AEGTS; Uncharacterized protein
  • STRING:  Traes_3DS_F9B6E4E1F.1  — (Triticum aestivum)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0008270  — Molecular Function — zinc ion binding

Family Introduction:

  • The human NF-X1 protein and homologous proteins in eukaryotes represent a class of transcription factors which are characterised by NF-X1 type zinc finger motifs. The Arabidopsis genome encodes two NF-X1 homologs, which we termed AtNFXL1 and AtNFXL2.
  • The Arabidopsis AtNFXL1 and AtNFXL2 proteins are characterized by NF-X1 type zinc fingers, which potentially mediate DNA binding, and PHD finger motifs, which potentially mediate protein interactions. The AtNFXL1 protein is part of a regulatory mechanism, which improves the physiological status of plants and supports growth and survival under stress.

Literature:

Sequences:

CDS Sequence:
  • >Traes_3DS_F9B6E4E1F.1|Triticum_aestivum|NF-X1|Traes_3DS_F9B6E4E1F.1
    GATTATCCAAGGTTGGAGTGTGATGTGGAGGCCGCGACATGTGGATCGACTTGTGAGAAGGTGCTTGGGTGCGGACGGCACAAGTGCCCCGAGCGGTGCCATCGTGGCCCGTGTGACGTGACCTGCCGGCTTGTGATAAAAAAGTCCTGCCGCTGTGGTGTTCTGAAGAAGGAGCTGCCTTGCCACCAAGACTTGACCTGCGAAAGGAAATGTCAGCGGTTTACGTGCCTGTGGACGCCACGC
Protein Sequence:
  • >Traes_3DS_F9B6E4E1F.1|Triticum_aestivum|NF-X1|Traes_3DS_F9B6E4E1F.1
    DYPRLECDVEAATCGSTCEKVLGCGRHKCPERCHRGPCDVTCRLVIKKSCRCGVLKKELPCHQDLTCERKCQRFTCLWTPR