Gene Details:
- Gene ID: Ote100110780031
- Gene Family: NF-X1 Family
- Description: NF-X1 Family protein
- Species: Ocimum tenuiflorum
- Source: NF-X1 family gene from PlantTFDB
Protein Features:
- SuperFamily: SSF57850
- PROSITE profile: PS50016
- PROSITE pattern: PS01359
- PROSITE profile: PS50089
- SMART: SM00438
- Pfam: PF01422
- Pfam: PF01424
- Gene3D: G3DSA:3.30.70.330
- InterPro: IPR019787 IPR019786 IPR001841 IPR000967 IPR001374 IPR012677
Annotation Proteins:
- Refseq: XP_011076693.1 — NF-X1-type zinc finger protein NFXL2
- Swissprot: Q9FFK8 — NFXL2_ARATH; NF-X1-type zinc finger protein NFXL2
- TrEMBL: A0A2G9GDU0 — A0A2G9GDU0_9LAMI; Transcription factor NF-X1
- STRING: XP_009586602.1 — (Nicotiana tomentosiformis)
Gene Ontology:
- GO:0007623 — Biological Process — circadian rhythm
- GO:0009651 — Biological Process — response to salt stress
- GO:0009908 — Biological Process — flower development
- GO:0010310 — Biological Process — regulation of hydrogen peroxide metabolic process
- GO:0042335 — Biological Process — cuticle development
- GO:0045892 — Biological Process — negative regulation of transcription, DNA-templated
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:2000037 — Biological Process — regulation of stomatal complex patterning
- GO:0005634 — Cellular Component — nucleus
- GO:0000987 — Molecular Function — core promoter proximal region sequence-specific DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0008270 — Molecular Function — zinc ion binding
Family Introduction:
- The human NF-X1 protein and homologous proteins in eukaryotes represent a class of transcription factors which are characterised by NF-X1 type zinc finger motifs. The Arabidopsis genome encodes two NF-X1 homologs, which we termed AtNFXL1 and AtNFXL2.
- The Arabidopsis AtNFXL1 and AtNFXL2 proteins are characterized by NF-X1 type zinc fingers, which potentially mediate DNA binding, and PHD finger motifs, which potentially mediate protein interactions. The AtNFXL1 protein is part of a regulatory mechanism, which improves the physiological status of plants and supports growth and survival under stress.
Literature:
- The AtNFXL1 gene encodes a NF-X1 type zinc finger protein required for growth under salt stress. DOI: 10.1016/j.febslet.2006.07.079 ; PMID: 16905136
Sequences:
CDS Sequence:
- >Ote100110780031|Ocimum_tenuiflorum|NF-X1|Ote100110780031
Protein Sequence:
- >Ote100110780031|Ocimum_tenuiflorum|NF-X1|Ote100110780031
MLSCGRHVCERGCHEGECGDCPSQGKRSCPCGKRVYEGVACDVSVPLCGATCGKLLSCGFHRCPERCHHGPCVETCRIVVTKSCRCRSFKKQVPCYQELTCERKCQKLRDCGRHACRRRCCDGDCPPCSEICDRKLRCRNHKCPAPCHRGACAPCPLMVRISCSCGKTHFEVPCGTETEQKPPKCPKPCSVAPLCRHAPNRKXXXXXXXXXXXXXXXXLIPHRCHYGACPPCRATCGERYPCGHECQLRCHGPAPPPCPEFTLKPKKKRANNPTEATPGSPCPPCPELVLRSCFGNHIGAERTMLCSNSADFSCDNLCGSPLPCGNHYCTYVCHPLKGHSSKIGESCEVCNLPCDKERDPKCPHPCPMRCHPEECPPCKTLIKRSCHCGSMVHVFECKYYNCMSEKEQMVARSCKGPCHRKLPNCTHLCPETCHPGPCPLPDKCSKKVTVRCGCQRLKKEWLCEDVQAAYCSSGCDPKEVLKNQFGVGLLPCDSDCKSKVKVPDVELHFRQVKPKEEKEGDKAPKRRRRKQRVHEEESVSRLQKIIGVARCLAMVVVVAAVVFASAYFGYKGLLWLSDWMNQIEARQRRRFSRV