Gene Details:

  • Gene ID: Ote100110780031
  • Gene Family: NF-X1 Family
  • Description: NF-X1 Family protein
  • Species: Ocimum tenuiflorum
  • Source: NF-X1 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_011076693.1  — NF-X1-type zinc finger protein NFXL2
  • Swissprot:  Q9FFK8  — NFXL2_ARATH; NF-X1-type zinc finger protein NFXL2
  • TrEMBL:  A0A2G9GDU0  — A0A2G9GDU0_9LAMI; Transcription factor NF-X1
  • STRING:  XP_009586602.1  — (Nicotiana tomentosiformis)

Gene Ontology:

  • GO:0007623  — Biological Process — circadian rhythm
  • GO:0009651  — Biological Process — response to salt stress
  • GO:0009908  — Biological Process — flower development
  • GO:0010310  — Biological Process — regulation of hydrogen peroxide metabolic process
  • GO:0042335  — Biological Process — cuticle development
  • GO:0045892  — Biological Process — negative regulation of transcription, DNA-templated
  • GO:0045893  — Biological Process — positive regulation of transcription, DNA-templated
  • GO:2000037  — Biological Process — regulation of stomatal complex patterning
  • GO:0005634  — Cellular Component — nucleus
  • GO:0000987  — Molecular Function — core promoter proximal region sequence-specific DNA binding
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0008270  — Molecular Function — zinc ion binding

Family Introduction:

  • The human NF-X1 protein and homologous proteins in eukaryotes represent a class of transcription factors which are characterised by NF-X1 type zinc finger motifs. The Arabidopsis genome encodes two NF-X1 homologs, which we termed AtNFXL1 and AtNFXL2.
  • The Arabidopsis AtNFXL1 and AtNFXL2 proteins are characterized by NF-X1 type zinc fingers, which potentially mediate DNA binding, and PHD finger motifs, which potentially mediate protein interactions. The AtNFXL1 protein is part of a regulatory mechanism, which improves the physiological status of plants and supports growth and survival under stress.

Literature:

Sequences:

CDS Sequence:
  • >Ote100110780031|Ocimum_tenuiflorum|NF-X1|Ote100110780031
Protein Sequence:
  • >Ote100110780031|Ocimum_tenuiflorum|NF-X1|Ote100110780031
    MLSCGRHVCERGCHEGECGDCPSQGKRSCPCGKRVYEGVACDVSVPLCGATCGKLLSCGFHRCPERCHHGPCVETCRIVVTKSCRCRSFKKQVPCYQELTCERKCQKLRDCGRHACRRRCCDGDCPPCSEICDRKLRCRNHKCPAPCHRGACAPCPLMVRISCSCGKTHFEVPCGTETEQKPPKCPKPCSVAPLCRHAPNRKXXXXXXXXXXXXXXXXLIPHRCHYGACPPCRATCGERYPCGHECQLRCHGPAPPPCPEFTLKPKKKRANNPTEATPGSPCPPCPELVLRSCFGNHIGAERTMLCSNSADFSCDNLCGSPLPCGNHYCTYVCHPLKGHSSKIGESCEVCNLPCDKERDPKCPHPCPMRCHPEECPPCKTLIKRSCHCGSMVHVFECKYYNCMSEKEQMVARSCKGPCHRKLPNCTHLCPETCHPGPCPLPDKCSKKVTVRCGCQRLKKEWLCEDVQAAYCSSGCDPKEVLKNQFGVGLLPCDSDCKSKVKVPDVELHFRQVKPKEEKEGDKAPKRRRRKQRVHEEESVSRLQKIIGVARCLAMVVVVAAVVFASAYFGYKGLLWLSDWMNQIEARQRRRFSRV