Gene Details:
- Gene ID: Ote100032270061
- Gene Family: NF-X1 Family
- Description: NF-X1 Family protein
- Species: Ocimum tenuiflorum
- Source: NF-X1 family gene from PlantTFDB
Protein Features:
- SuperFamily: SSF57850
- PROSITE profile: PS50016
- PROSITE pattern: PS01359
- PROSITE profile: PS50089
- SMART: SM00438
- Pfam: PF01422
- Pfam: PF01424
- Gene3D: G3DSA:3.30.70.330
- InterPro: IPR019787 IPR019786 IPR001841 IPR000967 IPR001374 IPR012677
Annotation Proteins:
- Refseq: XP_011083338.1 — NF-X1-type zinc finger protein NFXL1
- Swissprot: Q9SY59 — NFXL1_ARATH; NF-X1-type zinc finger protein NFXL1
- TrEMBL: A0A4D9AJG2 — A0A4D9AJG2_SALSN; Transcriptional repressor NF-X1
- STRING: Migut.D01221.1.p — (Erythranthe guttata)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0009642 — Biological Process — response to light intensity
- GO:0009651 — Biological Process — response to salt stress
- GO:0009697 — Biological Process — salicylic acid biosynthetic process
- GO:0010188 — Biological Process — response to microbial phytotoxin
- GO:0010310 — Biological Process — regulation of hydrogen peroxide metabolic process
- GO:0042742 — Biological Process — defense response to bacterium
- GO:0005634 — Cellular Component — nucleus
- GO:0000166 — Molecular Function — nucleotide binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0008270 — Molecular Function — zinc ion binding
Family Introduction:
- The human NF-X1 protein and homologous proteins in eukaryotes represent a class of transcription factors which are characterised by NF-X1 type zinc finger motifs. The Arabidopsis genome encodes two NF-X1 homologs, which we termed AtNFXL1 and AtNFXL2.
- The Arabidopsis AtNFXL1 and AtNFXL2 proteins are characterized by NF-X1 type zinc fingers, which potentially mediate DNA binding, and PHD finger motifs, which potentially mediate protein interactions. The AtNFXL1 protein is part of a regulatory mechanism, which improves the physiological status of plants and supports growth and survival under stress.
Literature:
- The AtNFXL1 gene encodes a NF-X1 type zinc finger protein required for growth under salt stress. DOI: 10.1016/j.febslet.2006.07.079 ; PMID: 16905136
Sequences:
CDS Sequence:
- >Ote100032270061|Ocimum_tenuiflorum|NF-X1|Ote100032270061
Protein Sequence:
- >Ote100032270061|Ocimum_tenuiflorum|NF-X1|Ote100032270061
MSSEQNRRRENNNYRPRHNNLSRNNRREWVPRGSAPVVAAVQVPPASVVGASQNENGNDGELVDRPVRPVVPNRNRTHGGSRGNPGXXXXXXKGRKRRWRGSIIVKTMLGCRRGSAPIWSCSSCYSIFHLSCIKKWARAPTSIDLSAEKNQGSNWRCPGCQSVQLMSAKEIRYTCFCSKRTDPPSDLYXXXXXXXXXCGEPCGKPLERELPGSGMSGEDMCPHSCVLQCHPGPCPPCKAFAPPCRCPCGKKVITTRCSDRKSVLTCGQRCDKLLDCGRHHCGRVCHVGPCDPCQVLVDASCFCKKKIEVLLCGEMIVKGEIRGQDGLFSCNLTCENKLKCGNHFCQETCHPGPCGECELLPEKIKACCCGKTSLNEDRKSCLDPIPTCSQICGKTLPCKLHYCQNVCHSGPCVPCNVLVTQKCRCGSTSRTVECYRTGPDGEKFTCDRPCGQKKSCGRHRCSXXXXRCCPLSNSSNSAMVDGNPHLCTMPCEKKLRCGQHSCISLCHSGHCPPCLETIFTDLTCACGRTSIPPPLPCGTPPPSCQYPCSVPQPCGHPSSHSCHFGDCPPCTVPIPKECVGGHVVLRSIPCGSKDIRCNKLCGKTRQCGLHACSRTCHPPPCDSSAASSSSLRTSCRQTCGAPRRDCRHTCMAICHPANPCPDVRCEFPVTITCSCGRINATVPCDAGGGSGGYSADTVLEASTIHKLPVPLQPAEENGQRIPLGQRKLMCDDECTKVERKKVLADAFGVTPPSLETLHFGDTACVSEVLSDLLRRDPKWVLAVEERCRWKLSVNAAGWEPKRFVIVHVTPKSKPPARILGVKSCNTSSMLQPPIFDHLVDMDPRLVVGLFDLPREGDISALVLRFGGECELVWLNDKNALAVFSDPGRAATAMRRLEQGSVYYGAVSVPQNGGASTVSSGASAWGSASTTSKDAASLKGNPWKKVVLQDSEFKESSWGAEEWTANAADPKLHHWKEKEVPIPASSNRWSVLESGSSSKSSDASAKIENLQKPTETSSSTSSASTRDESGLKLPLQQEGGSSEMSGDVVDDWEKAYD