Gene Details:

  • Gene ID: cra_locus_3323_iso_7
  • Gene Family: NF-X1 Family
  • Description: NF-X1 Family protein
  • Species: Catharanthus roseus
  • Source: NF-X1 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_027110794.1  — NF-X1-type zinc finger protein NFXL2
  • Swissprot:  Q9FFK8  — NFXL2_ARATH; NF-X1-type zinc finger protein NFXL2
  • TrEMBL:  A0A068V0H5  — A0A068V0H5_COFCA; Uncharacterized protein
  • STRING:  XP_009783479.1  — (Nicotiana sylvestris)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0005515  — Molecular Function — protein binding
  • GO:0008270  — Molecular Function — zinc ion binding

Family Introduction:

  • The human NF-X1 protein and homologous proteins in eukaryotes represent a class of transcription factors which are characterised by NF-X1 type zinc finger motifs. The Arabidopsis genome encodes two NF-X1 homologs, which we termed AtNFXL1 and AtNFXL2.
  • The Arabidopsis AtNFXL1 and AtNFXL2 proteins are characterized by NF-X1 type zinc fingers, which potentially mediate DNA binding, and PHD finger motifs, which potentially mediate protein interactions. The AtNFXL1 protein is part of a regulatory mechanism, which improves the physiological status of plants and supports growth and survival under stress.

Literature:

Sequences:

CDS Sequence:
  • >cra_locus_3323_iso_7|Catharanthus_roseus|NF-X1|cra_locus_3323_iso_7
Protein Sequence:
  • >cra_locus_3323_iso_7|Catharanthus_roseus|NF-X1|cra_locus_3323_iso_7
    XGDCPPCSEMCDRRLRCRNHKCPAPCHRGACAPCPVMVTISCACGETHFEVPCGTETQQKPPKCPKPCRLTPLCRHGAISKPHKCHYGACPTCRLICDEEYPCGHWCKLRCHGPRPPPLPEFTLKPKKKKSNHEPEYIPGSPCPPCPELVWRSCLGHHIGAERMMVCSDRTLFSCDNLCGSPLPCGNHYCTKLCHRLKSDSSKSDGHIQSESCDECNLPCQKDRDPPCSHPCPLHCHPGDCPPCRSLIKRSCHCGSMVHVFECIYYNTLFEKDQMVVRSCGGPCHRKLPNCPHX