Gene Details:

  • Gene ID: WALNUT_00019004-RA
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Juglans regia
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_018848601.1  — PREDICTED: uncharacterized protein LOC109011745
  • Swissprot:  F4IEY4  — TRB5_ARATH; Telomere repeat-binding factor 5
  • TrEMBL:  A0A2I4GXG5  — A0A2I4GXG5_JUGRE; uncharacterized protein LOC109011745
  • STRING:  Gorai.009G143000.1  — (Gossypium raimondii)
  • STRING:  EOY27161  — (Theobroma cacao)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >WALNUT_00019004-RA|Juglans_regia|MYB_related|WALNUT_00019004-RA
    ATGGGAAATCAGAAGCAGAAATGGACGGCGGAGGAGGAAGAAGCGCTGCTGGCTGGAGTGGCAAAGCACGGCCCTGGTAAATGGAAGAACATTCTCAAGGATCCCCATTTTGCCCCTTTCCTCACTCACCGCTCCAACATCGGCCTCAAGGTTCTCCTTCTTCTTCTTTTTTACCTTTTGCCACTATTCACTCCCTCATCCGCTCACCTTGCTTGA
Protein Sequence:
  • >WALNUT_00019004-RA|Juglans_regia|MYB_related|WALNUT_00019004-RA
    MGNQKQKWTAEEEEALLAGVAKHGPGKWKNILKDPHFAPFLTHRSNIGLKVLLLLLFYLLPLFTPSSAHLA