Gene Details:

  • Gene ID: Solyc03g098260.1.1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Solanum lycopersicum
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_006364392.1  — PREDICTED: transcriptional activator Myb-like isoform X1
  • Refseq:  XP_006364393.1  — PREDICTED: transcriptional activator Myb-like isoform X2
  • Refseq:  XP_010318340.1  — transcription factor MYB54-like
  • Refseq:  XP_015069302.1  — transcription factor MYB54-like isoform X1
  • Refseq:  XP_015069303.1  — transcription factor MYB54-like isoform X2
  • Swissprot:  Q9FX36  — MYB54_ARATH; Transcription factor MYB54
  • TrEMBL:  A0A3Q7FNT7  — A0A3Q7FNT7_SOLLC; Uncharacterized protein
  • TrEMBL:  M1D2B8  — M1D2B8_SOLTU; Uncharacterized protein
  • STRING:  Solyc03g098260.1.1  — (Solanum lycopersicum)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Solyc03g098260.1.1|Solanum_lycopersicum|MYB_related|Solyc03g098260.1.1
    ATGTGTAGCAGAGGGCATTGGAGGCCTCATGAAGATGAAAAATTGAGAGAGTTAGTTGCTAAATATGGACCTCATAATTGGAACGCTATTGCTCTAAACTTGCAAGGAAGATCAGGGCTTCAATAG
Protein Sequence:
  • >Solyc03g098260.1.1|Solanum_lycopersicum|MYB_related|Solyc03g098260.1.1
    MCSRGHWRPHEDEKLRELVAKYGPHNWNAIALNLQGRSGLQ*