Gene Details:

  • Gene ID: Solyc01g109690.1.1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Solanum lycopersicum
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_004230980.1  — protein RADIALIS-like 4
  • Swissprot:  Q1A173  — RADL6_ARATH; Protein RADIALIS-like 6
  • TrEMBL:  A0A3Q7FDR5  — A0A3Q7FDR5_SOLLC; Uncharacterized protein
  • STRING:  Solyc01g109690.1.1  — (Solanum lycopersicum)

Gene Ontology:

  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Solyc01g109690.1.1|Solanum_lycopersicum|MYB_related|Solyc01g109690.1.1
    ATGGCATCAAGCTCACTTCAATCTTCATCATGGACACCGCAGCAAAACAAGTTATTTGAAAGAGCGTTAGCTCAATTCGATAAGGACACACCTGACCGCTGGCAGAATGTGGCACGGGCCGTTGGTGGTGGAAAATCGGCCGATGAAGTGAAGAGACACTATGAAATTCTTATTGAGGATCTCAGGCGTATCGAATCGGGACGTGTTCCTCTTCCTAATTACACTCATGAACAACAAAGGTATTCTTAA
Protein Sequence:
  • >Solyc01g109690.1.1|Solanum_lycopersicum|MYB_related|Solyc01g109690.1.1
    MASSSLQSSSWTPQQNKLFERALAQFDKDTPDRWQNVARAVGGGKSADEVKRHYEILIEDLRRIESGRVPLPNYTHEQQRYS*