Gene Details:

  • Gene ID: PGSC0003DMP400023727
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Solanum tuberosum
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_006356065.1  — PREDICTED: myb-related protein Myb4-like
  • Swissprot:  Q9LTC4  — MYB15_ARATH; Transcription factor MYB15
  • TrEMBL:  M1B1F7  — M1B1F7_SOLTU; Uncharacterized protein
  • STRING:  PGSC0003DMT400034878  — (Solanum tuberosum)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >PGSC0003DMP400023727|Solanum_tuberosum|MYB_related|PGSC0003DMP400023727
    ATGGGCAGAGCACCTTGTTGTGAGAAAACGAGCTTGAAGAAAGGGCCATGGGATCACGAAGAAGATCAAATTCTCATCTCTTACATTAACAAAAATGGCCATAGCAATTGGCGTGCGCTCCCTAAACAAGCTGGTAATTGCTTAAAAATTACGATATAA
Protein Sequence:
  • >PGSC0003DMP400023727|Solanum_tuberosum|MYB_related|PGSC0003DMP400023727
    MGRAPCCEKTSLKKGPWDHEEDQILISYINKNGHSNWRALPKQAGNCLKITI*