Gene Details:

  • Gene ID: PGSC0003DMP400020008
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Solanum tuberosum
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_015166485.1  — PREDICTED: protein LHY isoform X1
  • Swissprot:  Q6R0H1  — LHY_ARATH; Protein LHY
  • TrEMBL:  M1ASR4  — M1ASR4_SOLTU; Uncharacterized protein
  • STRING:  PGSC0003DMT400029394  — (Solanum tuberosum)

Gene Ontology:

  • GO:0009409  — Biological Process — response to cold
  • GO:0009651  — Biological Process — response to salt stress
  • GO:0009723  — Biological Process — response to ethylene
  • GO:0009733  — Biological Process — response to auxin
  • GO:0009737  — Biological Process — response to abscisic acid
  • GO:0009739  — Biological Process — response to gibberellin
  • GO:0009751  — Biological Process — response to salicylic acid
  • GO:0009753  — Biological Process — response to jasmonic acid
  • GO:0042754  — Biological Process — negative regulation of circadian rhythm
  • GO:0043433  — Biological Process — negative regulation of sequence-specific DNA binding transcription factor activity
  • GO:0046686  — Biological Process — response to cadmium ion
  • GO:0048574  — Biological Process — long-day photoperiodism, flowering
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0044212  — Molecular Function — transcription regulatory region DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >PGSC0003DMP400020008|Solanum_tuberosum|MYB_related|PGSC0003DMP400020008
    ATGCGGTTCCTTTTGACAAGGAAACCTTATACAATCACTAAGCAACGAGAGCGATGGACGGAGGAGGAGCACAATAGGTTCCTAGAAGCTTTGAAACTCTATGGACGCGCTTGGCAGCGCATAGAAGAACATATAGGAACTAAAACTGCCGTGCAGATCAGAAGTCATGCGCAAAAGTTTTTTACAAAGGTCATTAGCTACCTTTGA
Protein Sequence:
  • >PGSC0003DMP400020008|Solanum_tuberosum|MYB_related|PGSC0003DMP400020008
    MRFLLTRKPYTITKQRERWTEEEHNRFLEALKLYGRAWQRIEEHIGTKTAVQIRSHAQKFFTKVISYL*