Gene Details:

  • Gene ID: PGSC0003DMP400000454
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Solanum tuberosum
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_006339799.1  — PREDICTED: MYB-like transcription factor ETC3
  • Refseq:  XP_015067517.1  — MYB-like transcription factor ETC3
  • Swissprot:  Q8GV05  — TRY_ARATH; Transcription factor TRY
  • TrEMBL:  K4AZV3  — K4AZV3_SOLLC; MYB-like transcriptional factor TRY
  • TrEMBL:  M0ZH05  — M0ZH05_SOLTU; Uncharacterized protein
  • STRING:  Solyc01g095640.1.1  — (Solanum lycopersicum)
  • STRING:  PGSC0003DMT400000600  — (Solanum tuberosum)

Gene Ontology:

  • GO:0010091  — Biological Process — trichome branching
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >PGSC0003DMP400000454|Solanum_tuberosum|MYB_related|PGSC0003DMP400000454
    ATGAGCAAGCAAGAAGAAGATCTTATTTACAGGATGCACAAACTTGTTGGAGACAGGTGGGGGCTTATAGCAGGTAGAATACCAGGAAGAACAGCAGAAGAAATAGAAAGGTTTTGGATAATGAGACACAGTGATGGGTTTGCACACAAGAGAAGACAAACAATTAAGAAAAGTCTACCACCTACATAA
Protein Sequence:
  • >PGSC0003DMP400000454|Solanum_tuberosum|MYB_related|PGSC0003DMP400000454
    MSKQEEDLIYRMHKLVGDRWGLIAGRIPGRTAEEIERFWIMRHSDGFAHKRRQTIKKSLPPT*