Gene Details:

  • Gene ID: orange1.1g048053m
  • Gene Name: CISIN_1g048053mg
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Citrus sinensis
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_006470240.1  — transcription factor MYB58-like
  • Swissprot:  Q9LTC4  — MYB15_ARATH; Transcription factor MYB15
  • TrEMBL:  A0A2H5QUT5  — A0A2H5QUT5_CITUN; Uncharacterized protein
  • STRING:  XP_006423463.1  — (Citrus clementina)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >orange1.1g048053m|Citrus_sinensis|MYB_related|orange1.1g048053m
    ATGGTGAGAGCCCCAACGTATGATGGAAGAGGAATGAAGAAAGGTGCATGGAGTAAAGAAGAAGATGATAAGTTAAGAGCTTATATTCTTAAATATGGCCACTGGAATTGGGCTCAACTTCCCAAGAGTGGCAAGAGTTGCAGGCTGCGATGGATGAACTACCTGAGGCCAGATATAAAACATGGGAACTACACCAAGGAAGAAGAAACCAAAAGGAAACGACTA
Protein Sequence:
  • >orange1.1g048053m|Citrus_sinensis|MYB_related|orange1.1g048053m
    MVRAPTYDGRGMKKGAWSKEEDDKLRAYILKYGHWNWAQLPKSGKSCRLRWMNYLRPDIKHGNYTKEEETKRKRL