Gene Details:

  • Gene ID: Niben101Scf02348g08004.1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Nicotiana benthamiana
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_009785472.1  — PREDICTED: transcription factor RAX1-like
  • TrEMBL:  A0A1U7WZZ4  — A0A1U7WZZ4_NICSY; transcription factor RAX1-like
  • STRING:  XP_009785472.1  — (Nicotiana sylvestris)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Niben101Scf02348g08004.1|Nicotiana_benthamiana|MYB_related|Niben101Scf02348g08004.1
Protein Sequence:
  • >Niben101Scf02348g08004.1|Nicotiana_benthamiana|MYB_related|Niben101Scf02348g08004.1
    MGRAPCCDKNSVKKGPWSPEEDAKLKSHIDQHGTGGNWIALPPKIGLKRCGKSCRLRWLNYLRPNLKHGGFSQEEDNIILSLYISIGSRTDNDIKNYWNTKLKKKLFGKRKNLRGKSQKQGSRKGRDQINSSMDSHNNIDTNPSWSEFPILQPIPYSNDEPRYSNDHTSIRKLLMKLGGKFCDDDDKPMNGALNPQYDPMDNSLMHPIYYDSINLISAAPIGVTNTSPFTNSHEYNVDGKAVCWADTDTEKRKLGERMGSDTSVALALNNGCNSTTELENMVYTNPQKLDDLEMLYEDMLNNKPSTTLGGSLDWERMNNLVFPFPPLVVSNNEGHHPATLLGALNELRYHRD