Gene Details:

  • Gene ID: Niben101Scf02293g00005.1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Nicotiana benthamiana
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_019252940.1  — PREDICTED: transcription factor MYB80
  • Swissprot:  Q7XQN1  — MYB80_ORYSJ; Transcription factor MYB80
  • TrEMBL:  A0A1J6I268  — A0A1J6I268_NICAT; Transcription factor myb80
  • STRING:  XP_009767695.1  — (Nicotiana sylvestris)

Gene Ontology:

  • GO:0010090  — Biological Process — trichome morphogenesis
  • GO:0048658  — Biological Process — anther wall tapetum development
  • GO:0005634  — Cellular Component — nucleus
  • GO:0043565  — Molecular Function — sequence-specific DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Niben101Scf02293g00005.1|Nicotiana_benthamiana|MYB_related|Niben101Scf02293g00005.1
Protein Sequence:
  • >Niben101Scf02293g00005.1|Nicotiana_benthamiana|MYB_related|Niben101Scf02293g00005.1
    MGRIPCCEKDNRCGKSCRLRWTNYLRPDLKHGQFSEAEEQTIVTLHSVLGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPFSHLISEIANTLSPPQVPHLAEAALGCFKDEMLHLLTKKRIGFQFQFQQFGMTNTVTTAPNNVPSTSVKHEDNKDETIEKIKYGLSRAIKEPEMLNPIKNWDTNNFPENGGFNYNFASLLNEGEGSPWNQSLCSGSTCTAGGELQQNKRIISNENCGENSEGGKEIVTRNGSTTMFNSDCVLWDISSDDLMNPMV