Gene Details:

  • Gene ID: Niben101Scf00611g11027.1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Nicotiana benthamiana
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_009757029.1  — PREDICTED: telomere repeat-binding factor 4-like
  • Refseq:  XP_016464151.1  — PREDICTED: telomere repeat-binding factor 4-like
  • Refseq:  XP_019249157.1  — PREDICTED: telomere repeat-binding factor 4
  • Swissprot:  Q6WLH4  — SMH3_MAIZE; Single myb histone 3
  • TrEMBL:  A0A1J6I4E4  — A0A1J6I4E4_NICAT; Telomere repeat-binding factor 4
  • TrEMBL:  A0A1S3ZIH5  — A0A1S3ZIH5_TOBAC; telomere repeat-binding factor 4-like
  • TrEMBL:  A0A1U7V475  — A0A1U7V475_NICSY; telomere repeat-binding factor 4-like
  • STRING:  XP_009757029.1  — (Nicotiana sylvestris)

Gene Ontology:

  • GO:0006334  — Biological Process — nucleosome assembly
  • GO:0000786  — Cellular Component — nucleosome
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Niben101Scf00611g11027.1|Nicotiana_benthamiana|MYB_related|Niben101Scf00611g11027.1
Protein Sequence:
  • >Niben101Scf00611g11027.1|Nicotiana_benthamiana|MYB_related|Niben101Scf00611g11027.1
    MGNPKQKWTSEEEEALRAGVAKHGAGKWKNIQRDPEFNHLLYSRSNIDLKDKWRNLNVSASGQGPRDKSRTQKVKADAPAAPLLITQGPVSSTPVLQDAAADTVMEDSSKCALDGKTASKYNQMIYDALSSLKEPNGSDTSTIVNFIEQRHEVPQNFRRLLSSRLRRLVQQDKLEKIENCYRIKKEVLERTKTATAKQKHVGPRQFPSSAYLGDTVEEAAKTAVYKVAEADNKSFVAAEAAKEEARVSKMAEDQESLLLLAKDIFDRCSQGGIVLMA