Gene Details:

  • Gene ID: KDD74844.1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Helicosporidium
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_011402112.1  — 4-hydroxyphenylpyruvate dioxygenase
  • TrEMBL:  A0A059LLD6  — A0A059LLD6_9CHLO; Uncharacterized protein (Fragment)
  • STRING:  A0A087STK9  — (Auxenochlorella protothecoides)

Gene Ontology:

  • GO:0009631  — Biological Process — cold acclimation
  • GO:0009733  — Biological Process — response to auxin
  • GO:0009735  — Biological Process — response to cytokinin
  • GO:0042127  — Biological Process — regulation of cell proliferation
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding
  • GO:0003713  — Molecular Function — transcription coactivator activity
  • GO:0008270  — Molecular Function — zinc ion binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >KDD74844.1|Helicosporidium|MYB_related|KDD74844.1
    ATGGCTCCGTTTTTGCTGGGGACGAGGAGCAAGCGGCGAAAGACTGCGGATGCAGCGGCTGCAGCCGGTGGTCCAGGCCGTGCCGAGAAGCGCCAAGGCGCGGGCCTGTACCACTGCGACTACTGCCACTGCGACGTGAGCCAGTCCATCCGCATCCGCTGCGCCGAGTGTCCCGACTTTGACCTGTGCGTGGACTGCTTCCGCGTGGGCGCGCAGGTGGGCGGGCACCGCTCGGACCACTCCTACCGCGTGGTGGACTCTCTGAGCTTCCCGCTCTACGAGCCTGGCTGGGGAGCAGACGACGAGCTGCTGCTGCTGGAGGCGCTGGAGCAGTGCGGGCTGCACGCCTGGCCGCGCGTGGCGCAGAGCCTGGGCCGCTCGCCCGAGGAGGTCCGCGCGCATTACGAGCGCGTCTACGTGGACGTTCCGTCCTTTCCTCTGCCGCGGGCGACGGCGGCGATGGCCGCCGTCGACGTGCGCGCCCTCATCGCGCAGCGCCGCGAGCGCCGCAGCGACGGCCCGGGCCCGAAGCG
Protein Sequence:
  • >KDD74844.1|Helicosporidium|MYB_related|KDD74844.1
    MAPFLLGTRSKRRKTADAAAAAGGPGRAEKRQGAGLYHCDYCHCDVSQSIRIRCAECPDFDLCVDCFRVGAQVGGHRSDHSYRVVDSLSFPLYEPGWGADDELLLLEALEQCGLHAWPRVAQSLGRSPEEVRAHYERVYVDVPSFPLPRATAAMAAVDVRALIAQRRERRSDGPGPKR