Gene Details:

  • Gene ID: Kaladp0062s0060.1.p
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Kalanchoe laxiflora
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_021978436.1  — transcription factor MYB108-like
  • Swissprot:  Q10MB4  — MYB2_ORYSJ; Transcription factor MYB2
  • TrEMBL:  A0A251U887  — A0A251U887_HELAN; Putative myb protein
  • STRING:  POPTR_0008s10080.1  — (Populus trichocarpa)
  • STRING:  XP_009791846.1  — (Nicotiana sylvestris)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Kaladp0062s0060.1.p|Kalanchoe_laxiflora|MYB_related|Kaladp0062s0060.1.p
    ATGATGGAGGACTTGAGGAGAGGCCCTTGGACGGATGAGGAAGATCGCATACTTTCTTCCTACATAGCCAAACATGGGGAAGGAAGGTGGAACTCGCTTGCACGCTGCGCAGGACTGAATCGAACAGGAAAGAGTTGCAGACTAAGATGGCTCAACTATCTCCGCCCAGATGTGCGACGTGGAAACATCTCCCTGGAAGAACAACTTCTCATTCTTGAGCTCCATTCCCGTTGGGGAAATAGGTAA
Protein Sequence:
  • >Kaladp0062s0060.1.p|Kalanchoe_laxiflora|MYB_related|Kaladp0062s0060.1.p
    MMEDLRRGPWTDEEDRILSSYIAKHGEGRWNSLARCAGLNRTGKSCRLRWLNYLRPDVRRGNISLEEQLLILELHSRWGNR*