Gene Details:

  • Gene ID: Kaladp0053s0025.6.p
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Kalanchoe laxiflora
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_021688202.1  — transcription factor CPC-like
  • Swissprot:  O22059  — CPC_ARATH; Transcription factor CPC
  • TrEMBL:  A0A067H333  — A0A067H333_CITSI; Uncharacterized protein
  • TrEMBL:  A0A2H5PG76  — A0A2H5PG76_CITUN; Uncharacterized protein
  • TrEMBL:  V4U236  — V4U236_9ROSI; Uncharacterized protein
  • STRING:  XP_006491245.1  — (Citrus sinensis)
  • STRING:  XP_006444875.1  — (Citrus clementina)

Gene Ontology:

  • GO:0009751  — Biological Process — response to salicylic acid
  • GO:0009753  — Biological Process — response to jasmonic acid
  • GO:0009913  — Biological Process — epidermal cell differentiation
  • GO:0010063  — Biological Process — positive regulation of trichoblast fate specification
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Kaladp0053s0025.6.p|Kalanchoe_laxiflora|MYB_related|Kaladp0053s0025.6.p
    ATGGAGAGGCACCGGCGCAAGCAACCCAGAATCAAGCAGCAGCAGCAGCAGAGGTCTTACTCTGAAGAAGTGAGCAGTTTAGAATGGGAGTTCATAAGCATGAGTGAGCAAGAAGAAGACCTCATCCACAGAATGTACAAGCTTGTTGGACCAAGGTGGGCTTTAATAGCTGGTAGAATACCAGGAAGGAAACCAGAAGAAGTAGAGAGGTTTTGGATAATGAGACATGGAGAAGTATTTGCCAACAGAAGAAGAGAGCTGAAGCAGAGACACTACAATCATAACTGCAGCAGCAGCAGCAACAACAACAATAATAATAATGAGTAA
Protein Sequence:
  • >Kaladp0053s0025.6.p|Kalanchoe_laxiflora|MYB_related|Kaladp0053s0025.6.p
    MERHRRKQPRIKQQQQQRSYSEEVSSLEWEFISMSEQEEDLIHRMYKLVGPRWALIAGRIPGRKPEEVERFWIMRHGEVFANRRRELKQRHYNHNCSSSSNNNNNNNE*