Gene Details:

  • Gene ID: Kaladp0043s0190.1.p
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Kalanchoe laxiflora
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_009109540.1  — PREDICTED: transcription repressor MYB4
  • Refseq:  XP_013656744.1  — transcription repressor MYB4-like
  • Swissprot:  P20026  — MYB1_HORVU; Myb-related protein Hv1
  • TrEMBL:  A0A287S1Z5  — A0A287S1Z5_HORVV; Uncharacterized protein
  • STRING:  Bra010736.1-P  — (Brassica rapa)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Kaladp0043s0190.1.p|Kalanchoe_laxiflora|MYB_related|Kaladp0043s0190.1.p
    ATGGGGAGGTCACCATGCTGCGAGAAAGCTCACACCAACAAGGGAGCGTGGACCAAGGAAGAGGATGACCGTCTCACCGCATACATCAAAGCCCACGGCGACGGCTGCTGGCGCTCCCTTCCCAAGGCCGCCGGCCTCCTCCGCTGCGGCAAGAGCTGCCGCCTTCGCTGGATCAACTACTTGAGGCCTGACGTCAAGCGCGGCAACTTCACTCATGATGAAGATGAACTCATCATCCACTTCCACAGCATCCTCGGCAACAAGTAA
Protein Sequence:
  • >Kaladp0043s0190.1.p|Kalanchoe_laxiflora|MYB_related|Kaladp0043s0190.1.p
    MGRSPCCEKAHTNKGAWTKEEDDRLTAYIKAHGDGCWRSLPKAAGLLRCGKSCRLRWINYLRPDVKRGNFTHDEDELIIHFHSILGNK*