Gene Details:

  • Gene ID: Itr_sc010104.1_g00001.1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Ipomoea trifida
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_002442159.1  — cell division cycle 5-like protein
  • Refseq:  XP_008801722.1  — cell division cycle 5-like protein
  • Refseq:  XP_008801723.1  — cell division cycle 5-like protein
  • Refseq:  XP_009631530.1  — PREDICTED: cell division cycle 5-like protein
  • Refseq:  XP_010039513.1  — PREDICTED: cell division cycle 5-like protein isoform X1
  • Refseq:  XP_010039520.1  — PREDICTED: cell division cycle 5-like protein isoform X2
  • Refseq:  XP_010246794.1  — PREDICTED: cell division cycle 5-like protein
  • Refseq:  XP_010660227.1  — PREDICTED: cell division cycle 5-like protein
  • Refseq:  XP_010914614.1  — cell division cycle 5-like protein
  • Refseq:  XP_010914622.1  — cell division cycle 5-like protein
  • Refseq:  XP_016455096.1  — PREDICTED: cell division cycle 5-like protein
  • Refseq:  XP_016516169.1  — PREDICTED: cell division cycle 5-like protein, partial
  • Refseq:  XP_016572257.1  — PREDICTED: cell division cycle 5-like protein isoform X1
  • Refseq:  XP_020198485.1  — cell division cycle 5-like protein isoform X1
  • Refseq:  XP_020198486.1  — cell division cycle 5-like protein isoform X2
  • Refseq:  XP_022159233.1  — cell division cycle 5-like protein
  • Refseq:  XP_022159234.1  — cell division cycle 5-like protein
  • Refseq:  XP_022960954.1  — cell division cycle 5-like protein isoform X1
  • Refseq:  XP_023533341.1  — cell division cycle 5-like protein isoform X1
  • Swissprot:  P92948  — CDC5L_ARATH; Cell division cycle 5-like protein
  • TrEMBL:  A0A438E904  — A0A438E904_VITVI; Cell division cycle 5-like protein
  • TrEMBL:  A0A438J9H2  — A0A438J9H2_VITVI; Cell division cycle 5-like protein
  • STRING:  VIT_14s0036g00500.t01  — (Vitis vinifera)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Itr_sc010104.1_g00001.1|Ipomoea_trifida|MYB_related|Itr_sc010104.1_g00001.1
    ATGAGGATTATGATCAAGGGAGGAGTATGGAAGAACACGGAGGATGAGATCCTGAAGGCGGCGGTCATGAAGTATGGCAAGAACCAGTGGGCCCGTATCTCCTCCCTTCTCGTTC
Protein Sequence:
  • >Itr_sc010104.1_g00001.1|Ipomoea_trifida|MYB_related|Itr_sc010104.1_g00001.1
    MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLV