Gene Details:
- Gene ID: Itr_sc010104.1_g00001.1
- Gene Family: MYB_related Family
- Description: MYB_related Family protein
- Species: Ipomoea trifida
- Source: MYB_related family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:4.10.60.10
- PROSITE profile: PS51294
- SuperFamily: SSF46689
- TIGRFAMs: TIGR01557
- SMART: SM00717
- Gene3D: G3DSA:1.10.10.60
- Pfam: PF00249
- InterPro: IPR001878 IPR017930 IPR009057 IPR006447 IPR001005
Annotation Proteins:
- Refseq: XP_002442159.1 — cell division cycle 5-like protein
- Refseq: XP_008801722.1 — cell division cycle 5-like protein
- Refseq: XP_008801723.1 — cell division cycle 5-like protein
- Refseq: XP_009631530.1 — PREDICTED: cell division cycle 5-like protein
- Refseq: XP_010039513.1 — PREDICTED: cell division cycle 5-like protein isoform X1
- Refseq: XP_010039520.1 — PREDICTED: cell division cycle 5-like protein isoform X2
- Refseq: XP_010246794.1 — PREDICTED: cell division cycle 5-like protein
- Refseq: XP_010660227.1 — PREDICTED: cell division cycle 5-like protein
- Refseq: XP_010914614.1 — cell division cycle 5-like protein
- Refseq: XP_010914622.1 — cell division cycle 5-like protein
- Refseq: XP_016455096.1 — PREDICTED: cell division cycle 5-like protein
- Refseq: XP_016516169.1 — PREDICTED: cell division cycle 5-like protein, partial
- Refseq: XP_016572257.1 — PREDICTED: cell division cycle 5-like protein isoform X1
- Refseq: XP_020198485.1 — cell division cycle 5-like protein isoform X1
- Refseq: XP_020198486.1 — cell division cycle 5-like protein isoform X2
- Refseq: XP_022159233.1 — cell division cycle 5-like protein
- Refseq: XP_022159234.1 — cell division cycle 5-like protein
- Refseq: XP_022960954.1 — cell division cycle 5-like protein isoform X1
- Refseq: XP_023533341.1 — cell division cycle 5-like protein isoform X1
- Swissprot: P92948 — CDC5L_ARATH; Cell division cycle 5-like protein
- TrEMBL: A0A438E904 — A0A438E904_VITVI; Cell division cycle 5-like protein
- TrEMBL: A0A438J9H2 — A0A438J9H2_VITVI; Cell division cycle 5-like protein
- STRING: VIT_14s0036g00500.t01 — (Vitis vinifera)
Gene Ontology:
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.
Literature:
- A novel leaf-specific myb-related protein with a single binding repeat. DOI: 10.1016/s0378-1119(96)00521-5 ; PMID: 8996094
Sequences:
CDS Sequence:
- >Itr_sc010104.1_g00001.1|Ipomoea_trifida|MYB_related|Itr_sc010104.1_g00001.1
ATGAGGATTATGATCAAGGGAGGAGTATGGAAGAACACGGAGGATGAGATCCTGAAGGCGGCGGTCATGAAGTATGGCAAGAACCAGTGGGCCCGTATCTCCTCCCTTCTCGTTC
Protein Sequence:
- >Itr_sc010104.1_g00001.1|Ipomoea_trifida|MYB_related|Itr_sc010104.1_g00001.1
MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLV