Gene Details:

  • Gene ID: Itr_sc006654.1_g00001.1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Ipomoea trifida
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_019200152.1  — PREDICTED: myb-related protein Myb4-like isoform X1
  • Refseq:  XP_019200153.1  — PREDICTED: myb-related protein Myb4-like isoform X2
  • Swissprot:  Q9LDR8  — MY102_ARATH; Transcription factor MYB102
  • TrEMBL:  A0A328E3D0  — A0A328E3D0_9ASTE; Uncharacterized protein
  • STRING:  Solyc08g082890.2.1  — (Solanum lycopersicum)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Itr_sc006654.1_g00001.1|Ipomoea_trifida|MYB_related|Itr_sc006654.1_g00001.1
    ATGGGAAGAGCTCCTTGCTGTTCTAAAGAAGGGTTGAAGAAGGGCCCTTGGTCTACCAAAGAAGATTTACTCCTCACCAATTACATTCAGCAACATGGCGAAGGCCAGTGGAGATCTTTGCCCAAAAAAGCTG
Protein Sequence:
  • >Itr_sc006654.1_g00001.1|Ipomoea_trifida|MYB_related|Itr_sc006654.1_g00001.1
    MGRAPCCSKEGLKKGPWSTKEDLLLTNYIQQHGEGQWRSLPKKA