Gene Details:

  • Gene ID: Itr_sc000653.1_g00001.1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Ipomoea trifida
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_019170538.1  — PREDICTED: transcription factor MYB39-like
  • Swissprot:  Q9LXF1  — MYB16_ARATH; Transcription factor MYB16
  • TrEMBL:  A0A1S2Z8L5  — A0A1S2Z8L5_CICAR; transcription factor MYB106-like
  • TrEMBL:  A9P0V4  — A9P0V4_PICSI; Uncharacterized protein
  • STRING:  XP_004517012.1  — (Cicer arietinum)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Itr_sc000653.1_g00001.1|Ipomoea_trifida|MYB_related|Itr_sc000653.1_g00001.1
    ATGGGAAGTTCAGCATGCTGTGAAAATGTAGGGTTGAAGAAAGGGCCATGGACACCTGATGAAGACCAGAAGCTGGTTGCTTACGTTCAGCAGTACGGCCATGGAAGCTGGCTTGCTTTGCCTTCAAAAGCTGGTATTCTATACATTATTCTTTCTTTCTTTCTTTTGGTTGACATTTGA
Protein Sequence:
  • >Itr_sc000653.1_g00001.1|Ipomoea_trifida|MYB_related|Itr_sc000653.1_g00001.1
    MGSSACCENVGLKKGPWTPDEDQKLVAYVQQYGHGSWLALPSKAGILYIILSFFLLVDI