Gene Details:
- Gene ID: gw1.9.308.1
- Gene Name: CHLNCDRAFT_15057
- Gene Family: MYB_related Family
- Description: MYB_related Family protein
- Species: Chlorella variabilis NC64A
- Source: MYB_related family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:4.10.60.10
- PROSITE profile: PS51294
- SuperFamily: SSF46689
- TIGRFAMs: TIGR01557
- SMART: SM00717
- Gene3D: G3DSA:1.10.10.60
- Pfam: PF00249
- InterPro: IPR001878 IPR017930 IPR009057 IPR006447 IPR001005
Annotation Proteins:
- Refseq: XP_005847876.1 — hypothetical protein CHLNCDRAFT_15057, partial
- Swissprot: P92973 — CCA1_ARATH; Protein CCA1
- TrEMBL: E1ZDY2 — E1ZDY2_CHLVA; Uncharacterized protein (Fragment)
- STRING: XP_005847876.1 — (Chlorella variabilis)
Gene Ontology:
- GO:0009409 — Biological Process — response to cold
- GO:0009651 — Biological Process — response to salt stress
- GO:0009723 — Biological Process — response to ethylene
- GO:0009733 — Biological Process — response to auxin
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009739 — Biological Process — response to gibberellin
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0010243 — Biological Process — response to organonitrogen compound
- GO:0042754 — Biological Process — negative regulation of circadian rhythm
- GO:0043496 — Biological Process — regulation of protein homodimerization activity
- GO:0045892 — Biological Process — negative regulation of transcription, DNA-templated
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:0046686 — Biological Process — response to cadmium ion
- GO:0048574 — Biological Process — long-day photoperiodism, flowering
- GO:0005634 — Cellular Component — nucleus
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction:
- A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.
Literature:
- A novel leaf-specific myb-related protein with a single binding repeat. DOI: 10.1016/s0378-1119(96)00521-5 ; PMID: 8996094
Sequences:
CDS Sequence:
- >gw1.9.308.1|Chlorella_variabilis_NC64A|MYB_related|gw1.9.308.1
ACCCTGCAGATGCGCAAGCCCTACACAATCACCAAGCAGCGCGAGCGCTGGACGGATGAGGAGCACGACCGCTTCGTGGAGGCGCTGCGCCTCCACGGGCGGCAGTGGCGCAAGATAGAGGGCCATGTCAAGACCAAGACTGCCGTGCAGATCCGGTCGCACGCCCAGAAGTTCTTCAGCAAGCTCGAGAAGCAGCAGATGCAGCTGCAGGCGGGGCTGCAGCCCACCCTGGACCTGGCGGTGCCGCCGCCGCGCCCCAAGCGCAAG
Protein Sequence:
- >gw1.9.308.1|Chlorella_variabilis_NC64A|MYB_related|gw1.9.308.1
TLQMRKPYTITKQRERWTDEEHDRFVEALRLHGRQWRKIEGHVKTKTAVQIRSHAQKFFSKLEKQQMQLQAGLQPTLDLAVPPPRPKRK