Gene Details:

  • Gene ID: gw1.9.308.1
  • Gene Name: CHLNCDRAFT_15057
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Chlorella variabilis NC64A
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_005847876.1  — hypothetical protein CHLNCDRAFT_15057, partial
  • Swissprot:  P92973  — CCA1_ARATH; Protein CCA1
  • TrEMBL:  E1ZDY2  — E1ZDY2_CHLVA; Uncharacterized protein (Fragment)
  • STRING:  XP_005847876.1  — (Chlorella variabilis)

Gene Ontology:

  • GO:0009409  — Biological Process — response to cold
  • GO:0009651  — Biological Process — response to salt stress
  • GO:0009723  — Biological Process — response to ethylene
  • GO:0009733  — Biological Process — response to auxin
  • GO:0009737  — Biological Process — response to abscisic acid
  • GO:0009739  — Biological Process — response to gibberellin
  • GO:0009751  — Biological Process — response to salicylic acid
  • GO:0009753  — Biological Process — response to jasmonic acid
  • GO:0010243  — Biological Process — response to organonitrogen compound
  • GO:0042754  — Biological Process — negative regulation of circadian rhythm
  • GO:0043496  — Biological Process — regulation of protein homodimerization activity
  • GO:0045892  — Biological Process — negative regulation of transcription, DNA-templated
  • GO:0045893  — Biological Process — positive regulation of transcription, DNA-templated
  • GO:0046686  — Biological Process — response to cadmium ion
  • GO:0048574  — Biological Process — long-day photoperiodism, flowering
  • GO:0005634  — Cellular Component — nucleus
  • GO:0043565  — Molecular Function — sequence-specific DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >gw1.9.308.1|Chlorella_variabilis_NC64A|MYB_related|gw1.9.308.1
    ACCCTGCAGATGCGCAAGCCCTACACAATCACCAAGCAGCGCGAGCGCTGGACGGATGAGGAGCACGACCGCTTCGTGGAGGCGCTGCGCCTCCACGGGCGGCAGTGGCGCAAGATAGAGGGCCATGTCAAGACCAAGACTGCCGTGCAGATCCGGTCGCACGCCCAGAAGTTCTTCAGCAAGCTCGAGAAGCAGCAGATGCAGCTGCAGGCGGGGCTGCAGCCCACCCTGGACCTGGCGGTGCCGCCGCCGCGCCCCAAGCGCAAG
Protein Sequence:
  • >gw1.9.308.1|Chlorella_variabilis_NC64A|MYB_related|gw1.9.308.1
    TLQMRKPYTITKQRERWTDEEHDRFVEALRLHGRQWRKIEGHVKTKTAVQIRSHAQKFFSKLEKQQMQLQAGLQPTLDLAVPPPRPKRK