Gene Details:
- Gene ID: gw1.6.1691.1
- Gene Family: MYB_related Family
- Description: MYB_related Family protein
- Species: Ostreococcus sp. RCC809
- Source: MYB_related family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:4.10.60.10
- PROSITE profile: PS51294
- SuperFamily: SSF46689
- TIGRFAMs: TIGR01557
- SMART: SM00717
- Gene3D: G3DSA:1.10.10.60
- Pfam: PF00249
- InterPro: IPR001878 IPR017930 IPR009057 IPR006447 IPR001005
Annotation Proteins:
- Refseq: XP_001418177.1 — predicted protein, partial
- Refseq: XP_022839179.1 — Myb domain, plants
- Swissprot: Q9LVS0 — KUA1_ARATH; Transcription factor KUA1
- TrEMBL: A0A090M6H0 — A0A090M6H0_OSTTA; Myb domain, plants
- TrEMBL: A0A1Y5IKD3 — A0A1Y5IKD3_OSTTA; Uncharacterized protein
- TrEMBL: A4RYK1 — A4RYK1_OSTLU; Uncharacterized protein (Fragment)
- STRING: ABO96470 — (Ostreococcus ’lucimarinus')
- STRING: A0A090M6H0 — (Ostreococcus tauri)
Gene Ontology:
- GO:0000122 — Biological Process — negative regulation of transcription from RNA polymerase II promoter
- GO:0009651 — Biological Process — response to salt stress
- GO:0009723 — Biological Process — response to ethylene
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009739 — Biological Process — response to gibberellin
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0030307 — Biological Process — positive regulation of cell growth
- GO:0046686 — Biological Process — response to cadmium ion
- GO:0048366 — Biological Process — leaf development
- GO:2000469 — Biological Process — negative regulation of peroxidase activity
- GO:0000976 — Molecular Function — transcription regulatory region sequence-specific DNA binding
Family Introduction:
- A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.
Literature:
- A novel leaf-specific myb-related protein with a single binding repeat. DOI: 10.1016/s0378-1119(96)00521-5 ; PMID: 8996094
Sequences:
CDS Sequence:
- >gw1.6.1691.1|Ostreococcus_sp._RCC809|MYB_related|gw1.6.1691.1
GTAGGCGTGGCGTGGACGGAGGAAGAACATAAAAACTTTTTGATCGGGTTGCAAAAACTCGGGAAAGGGGACTGGCGCGGCATCTCGAGACACTTCGTCACGACGAGGACGCCGACGCAGGTTGCGTCGCACGCGCAAAAGTACTTCATCAGGCAAACGAACGTGAGCAAACGGAAGAGACGGTCGAGTTTGTTTGATATCGTCGCCGCTCCG
Protein Sequence:
- >gw1.6.1691.1|Ostreococcus_sp._RCC809|MYB_related|gw1.6.1691.1
VGVAWTEEEHKNFLIGLQKLGKGDWRGISRHFVTTRTPTQVASHAQKYFIRQTNVSKRKRRSSLFDIVAAP