Gene Details:

  • Gene ID: gw1.6.1691.1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Ostreococcus sp. RCC809
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_001418177.1  — predicted protein, partial
  • Refseq:  XP_022839179.1  — Myb domain, plants
  • Swissprot:  Q9LVS0  — KUA1_ARATH; Transcription factor KUA1
  • TrEMBL:  A0A090M6H0  — A0A090M6H0_OSTTA; Myb domain, plants
  • TrEMBL:  A0A1Y5IKD3  — A0A1Y5IKD3_OSTTA; Uncharacterized protein
  • TrEMBL:  A4RYK1  — A4RYK1_OSTLU; Uncharacterized protein (Fragment)
  • STRING:  ABO96470  — (Ostreococcus ’lucimarinus')
  • STRING:  A0A090M6H0  — (Ostreococcus tauri)

Gene Ontology:

  • GO:0000122  — Biological Process — negative regulation of transcription from RNA polymerase II promoter
  • GO:0009651  — Biological Process — response to salt stress
  • GO:0009723  — Biological Process — response to ethylene
  • GO:0009737  — Biological Process — response to abscisic acid
  • GO:0009739  — Biological Process — response to gibberellin
  • GO:0009751  — Biological Process — response to salicylic acid
  • GO:0009753  — Biological Process — response to jasmonic acid
  • GO:0030307  — Biological Process — positive regulation of cell growth
  • GO:0046686  — Biological Process — response to cadmium ion
  • GO:0048366  — Biological Process — leaf development
  • GO:2000469  — Biological Process — negative regulation of peroxidase activity
  • GO:0000976  — Molecular Function — transcription regulatory region sequence-specific DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >gw1.6.1691.1|Ostreococcus_sp._RCC809|MYB_related|gw1.6.1691.1
    GTAGGCGTGGCGTGGACGGAGGAAGAACATAAAAACTTTTTGATCGGGTTGCAAAAACTCGGGAAAGGGGACTGGCGCGGCATCTCGAGACACTTCGTCACGACGAGGACGCCGACGCAGGTTGCGTCGCACGCGCAAAAGTACTTCATCAGGCAAACGAACGTGAGCAAACGGAAGAGACGGTCGAGTTTGTTTGATATCGTCGCCGCTCCG
Protein Sequence:
  • >gw1.6.1691.1|Ostreococcus_sp._RCC809|MYB_related|gw1.6.1691.1
    VGVAWTEEEHKNFLIGLQKLGKGDWRGISRHFVTTRTPTQVASHAQKYFIRQTNVSKRKRRSSLFDIVAAP