Gene Details:

  • Gene ID: GSVIVT01018944001
  • Gene Name: VIT_04s0023g01910
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Vitis vinifera
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_010649137.1  — PREDICTED: protein RADIALIS-like 3
  • Swissprot:  Q58FS3  — RAD_ANTMA; Transcription factor RADIALIS
  • TrEMBL:  D7SPC6  — D7SPC6_VITVI; Uncharacterized protein
  • STRING:  VIT_04s0023g01910.t01  — (Vitis vinifera)

Gene Ontology:

  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >GSVIVT01018944001|Vitis_vinifera|MYB_related|GSVIVT01018944001
    ATGACTTCTTCACGTACCTCTGGCTCCTCTTGGACGCCCAAGCAAAACAAACTATTTGAAAAGGCACTGGCAAAGTATGACAAGGACACCCCTGACCGCTGGCAGAATATTGCCAAGGCCGTGGGTGGGAAATCTGCGGAGGAAGTGAAAAGGCACTATGAAATCCTCATAGAGGATGTCAAGCACATCGAGTCCGGCAAAGTTCCATTTCCCAATTACAGGTGA
Protein Sequence:
  • >GSVIVT01018944001|Vitis_vinifera|MYB_related|GSVIVT01018944001
    MTSSRTSGSSWTPKQNKLFEKALAKYDKDTPDRWQNIAKAVGGKSAEEVKRHYEILIEDVKHIESGKVPFPNYR*