Gene Details:

  • Gene ID: GSBRNA2T00032588001
  • Gene Name: GSBRNA2T00114104001
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Brassica napus
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  NP_001077814.1  — Homeodomain-like/winged-helix DNA-binding family protein
  • Refseq:  NP_177418.2  — Homeodomain-like/winged-helix DNA-binding family protein
  • Refseq:  XP_006416694.1  — telomere repeat-binding factor 4 isoform X3
  • Refseq:  XP_024008305.1  — telomere repeat-binding factor 4 isoform X1
  • Refseq:  XP_024008306.1  — telomere repeat-binding factor 4 isoform X2
  • Swissprot:  F4IEY4  — TRB5_ARATH; Telomere repeat-binding factor 5
  • TrEMBL:  A0A397Y6S3  — A0A397Y6S3_BRACM; Uncharacterized protein
  • TrEMBL:  M4EQ23  — M4EQ23_BRARP; Uncharacterized protein
  • STRING:  Bra030894.1-P  — (Brassica rapa)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >GSBRNA2T00032588001|Brassica_napus|MYB_related|GSBRNA2T00032588001
    ATGTACGCACAGAGGAGGAAGTGGTCGGCGGAAGAAGAGGAGGCGCTTCTCGCCGGAATATGCAAGTACGGTCCGGGAAAGTGGTCTTATATTATCAACGATCCTGAGTTCAGGGCTCAACTTTCTAATCGCACTAACATTGACCTCAAGGACAAATGGCGTAATATGACTATCAAGGAGGAAGCGAAGACTTTAGTTAATAAGATATGA
Protein Sequence:
  • >GSBRNA2T00032588001|Brassica_napus|MYB_related|GSBRNA2T00032588001
    MYAQRRKWSAEEEEALLAGICKYGPGKWSYIINDPEFRAQLSNRTNIDLKDKWRNMTIKEEAKTLVNKI*