Gene Details:

  • Gene ID: GSBRNA2T00028222001
  • Gene Name: GSBRNA2T00028218001, GSBRNA2T00028222001, LOC106374496, LOC106376140
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Brassica napus
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_013587526.1  — PREDICTED: transcription factor TRY-like
  • Refseq:  XP_013669961.1  — transcription factor TRY-like
  • Refseq:  XP_013671656.1  — transcription factor TRY-like
  • Swissprot:  Q8GV05  — TRY_ARATH; Transcription factor TRY
  • TrEMBL:  A0A078J2S4  — A0A078J2S4_BRANA; BnaCnng35720D protein
  • STRING:  Bra026297.1-P  — (Brassica rapa)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >GSBRNA2T00028222001|Brassica_napus|MYB_related|GSBRNA2T00028222001
    ATGGATTCAACGTATCGACGTCAGCGTCACAACTCTGAAGAAGTGTGTAGCGTAAAGTGGGATTTCATCAAAATGAGCCAACAGGAGGAAGATCTCATCTTAAGAATGTACAGACTCGTAGGCGATAGGTGGGAAATAATAGCAGGAAGAGTACCGGGAAGAAAAGCTGTGGAGATAGAGAGATATTGGATCATGAGAAACAACACACATTTCTTGCCTCCATCTTCCAAATTTTAA
Protein Sequence:
  • >GSBRNA2T00028222001|Brassica_napus|MYB_related|GSBRNA2T00028222001
    MDSTYRRQRHNSEEVCSVKWDFIKMSQQEEDLILRMYRLVGDRWEIIAGRVPGRKAVEIERYWIMRNNTHFLPPSSKF*