Gene Details:

  • Gene ID: GRMZM2G325907_P02
  • Gene Name: ZEAMMB73_063283, Zm.13894
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Zea mays
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_013673354.1  — transcription factor MYB86-like
  • Swissprot:  Q9SPG3  — MYB26_ARATH; Transcription factor MYB26
  • TrEMBL:  A0A397XTA4  — A0A397XTA4_BRACM; Uncharacterized protein
  • TrEMBL:  A0A3P5XXF1  — A0A3P5XXF1_BRACM; Uncharacterized protein
  • STRING:  Bra027668.1-P  — (Brassica rapa)
  • STRING:  Bo9g029530.1  — (Brassica oleracea)

Gene Ontology:

  • GO:0045893  — Biological Process — positive regulation of transcription, DNA-templated
  • GO:1901430  — Biological Process — positive regulation of syringal lignin biosynthetic process
  • GO:2000652  — Biological Process — regulation of secondary cell wall biogenesis
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >GRMZM2G325907_P02|Zea_mays|MYB_related|GRMZM2G325907_P02
    ATGGGGCATCACTCCTGCTGCAACCAGCAGAAGGTGAAGAGGGGGCTCTGGTCCCCTGAGGAGGACGAGAAGCTCATCAGGTACATCACCACCCATGGCTACGGGTGCTGGAGCGAGGTCCCCGAGAAGGCCGGTACGTATAGATCGAGGCGGCTATGTTCTCTCTCTCTTGAATTGAATCTTGATGCCTTGCCTCCACCGTGCATGCATATAGACCAATCAGTTTGTCGTTGCTGCTGGTGA
Protein Sequence:
  • >GRMZM2G325907_P02|Zea_mays|MYB_related|GRMZM2G325907_P02
    MGHHSCCNQQKVKRGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGTYRSRRLCSLSLELNLDALPPPCMHIDQSVCRCCW