Gene Details:

  • Gene ID: GRMZM2G136887_P01
  • Gene Name: LOC100274000, ZEAMMB73_836537
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Zea mays
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  NP_001141858.1  — single myb histone 1
  • Swissprot:  Q6WS85  — SMH1_MAIZE; Single myb histone 1
  • TrEMBL:  A0A3L6R1A1  — A0A3L6R1A1_PANMI; Single myb histone 1-like
  • STRING:  GRMZM2G136887_P02  — (Zea mays)

Gene Ontology:

  • GO:0006334  — Biological Process — nucleosome assembly
  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0000781  — Cellular Component — chromosome, telomeric region
  • GO:0000786  — Cellular Component — nucleosome
  • GO:0005730  — Cellular Component — nucleolus
  • GO:0003691  — Molecular Function — double-stranded telomeric DNA binding
  • GO:0042803  — Molecular Function — protein homodimerization activity
  • GO:0043047  — Molecular Function — single-stranded telomeric DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >GRMZM2G136887_P01|Zea_mays|MYB_related|GRMZM2G136887_P01
    ATGGGGGCGCCGAAGCAGCGCTGGACGCCGGAGGAAGAGGCCGCTCTCAAGGCCGGCGTCGCCAAGCACGGGCCCGGCAAGTGGCGCACCATCCTCCGGGACTCGGACTTCAGCGCGCTCCTGCGCCTCCGCTCCAATGTTGACCTCAAGGTGACGCTCGGATCGCCAGGGAGGGTGGGCGGTGGGTTTTTGGCGATCAGCTGA
Protein Sequence:
  • >GRMZM2G136887_P01|Zea_mays|MYB_related|GRMZM2G136887_P01
    MGAPKQRWTPEEEAALKAGVAKHGPGKWRTILRDSDFSALLRLRSNVDLKVTLGSPGRVGGGFLAIS