Gene Details:
- Gene ID: GRMZM2G136887_P01
- Gene Name: LOC100274000, ZEAMMB73_836537
- Gene Family: MYB_related Family
- Description: MYB_related Family protein
- Species: Zea mays
- Source: MYB_related family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:4.10.60.10
- PROSITE profile: PS51294
- SuperFamily: SSF46689
- TIGRFAMs: TIGR01557
- SMART: SM00717
- Gene3D: G3DSA:1.10.10.60
- Pfam: PF00249
- InterPro: IPR001878 IPR017930 IPR009057 IPR006447 IPR001005
Annotation Proteins:
- Refseq: NP_001141858.1 — single myb histone 1
- Swissprot: Q6WS85 — SMH1_MAIZE; Single myb histone 1
- TrEMBL: A0A3L6R1A1 — A0A3L6R1A1_PANMI; Single myb histone 1-like
- STRING: GRMZM2G136887_P02 — (Zea mays)
Gene Ontology:
- GO:0006334 — Biological Process — nucleosome assembly
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0000781 — Cellular Component — chromosome, telomeric region
- GO:0000786 — Cellular Component — nucleosome
- GO:0005730 — Cellular Component — nucleolus
- GO:0003691 — Molecular Function — double-stranded telomeric DNA binding
- GO:0042803 — Molecular Function — protein homodimerization activity
- GO:0043047 — Molecular Function — single-stranded telomeric DNA binding
Family Introduction:
- A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.
Literature:
- A novel leaf-specific myb-related protein with a single binding repeat. DOI: 10.1016/s0378-1119(96)00521-5 ; PMID: 8996094
Sequences:
CDS Sequence:
- >GRMZM2G136887_P01|Zea_mays|MYB_related|GRMZM2G136887_P01
ATGGGGGCGCCGAAGCAGCGCTGGACGCCGGAGGAAGAGGCCGCTCTCAAGGCCGGCGTCGCCAAGCACGGGCCCGGCAAGTGGCGCACCATCCTCCGGGACTCGGACTTCAGCGCGCTCCTGCGCCTCCGCTCCAATGTTGACCTCAAGGTGACGCTCGGATCGCCAGGGAGGGTGGGCGGTGGGTTTTTGGCGATCAGCTGA
Protein Sequence:
- >GRMZM2G136887_P01|Zea_mays|MYB_related|GRMZM2G136887_P01
MGAPKQRWTPEEEAALKAGVAKHGPGKWRTILRDSDFSALLRLRSNVDLKVTLGSPGRVGGGFLAIS