Gene Details:

  • Gene ID: GRMZM2G127490_P02
  • Gene Name: LOC100193483, ZEAMMB73_817277
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Zea mays
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • TrEMBL:  A0A1E5VFV2  — A0A1E5VFV2_9POAL; Transcription factor MYB86

Gene Ontology:

  • GO:0001944  — Biological Process — vasculature development
  • GO:0009733  — Biological Process — response to auxin
  • GO:0010089  — Biological Process — xylem development
  • GO:0010119  — Biological Process — regulation of stomatal movement
  • GO:0010214  — Biological Process — seed coat development
  • GO:0048364  — Biological Process — root development
  • GO:0003677  — Molecular Function — DNA binding
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >GRMZM2G127490_P02|Zea_mays|MYB_related|GRMZM2G127490_P02
    ATGGGGAGGCATTCTTGCTGCTACAAGCAAAAGTTGAGAAAGGGGCTCTGGTCCCCCGAGGAGGATGAGAAACTCATGAACCACATAACAAAGCATGGCCATGGCTGCTGGAGTTCTATTCCCAAACTCGCTGGTATGTACAACAATTTTTTTTCTTCCCTTTGGTCCTCAGTTATCAACTCTCAATTCTCCCCTTCTTCCTCTGCATTTTTCTCGTTCCAGTTGCCAACTGAAATCTCTCTCTCTCTCCTGTCTCTCAAATACCTCTTGGTCAGTTCAATTACCTAA
Protein Sequence:
  • >GRMZM2G127490_P02|Zea_mays|MYB_related|GRMZM2G127490_P02
    MGRHSCCYKQKLRKGLWSPEEDEKLMNHITKHGHGCWSSIPKLAGMYNNFFSSLWSSVINSQFSPSSSAFFSFQLPTEISLSLLSLKYLLVSSIT