Gene Details:

  • Gene ID: GRMZM2G095239_P02
  • Gene Name: MYBR27, Zm.17144
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Zea mays
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  NP_001105670.1  — single myb histone 6
  • Swissprot:  C0HIA3  — SMH6_MAIZE; Single myb histone 6
  • TrEMBL:  A0A060CVA2  — A0A060CVA2_MAIZE; MYB-related transcription factor (Fragment)
  • STRING:  GRMZM2G095239_P01  — (Zea mays)

Gene Ontology:

  • GO:0006334  — Biological Process — nucleosome assembly
  • GO:0006357  — Biological Process — regulation of transcription from RNA polymerase II promoter
  • GO:0009651  — Biological Process — response to salt stress
  • GO:0009723  — Biological Process — response to ethylene
  • GO:0009733  — Biological Process — response to auxin
  • GO:0009737  — Biological Process — response to abscisic acid
  • GO:0009739  — Biological Process — response to gibberellin
  • GO:0009751  — Biological Process — response to salicylic acid
  • GO:0009753  — Biological Process — response to jasmonic acid
  • GO:0046686  — Biological Process — response to cadmium ion
  • GO:0000781  — Cellular Component — chromosome, telomeric region
  • GO:0000786  — Cellular Component — nucleosome
  • GO:0005730  — Cellular Component — nucleolus
  • GO:0003691  — Molecular Function — double-stranded telomeric DNA binding
  • GO:0033613  — Molecular Function — activating transcription factor binding
  • GO:0042803  — Molecular Function — protein homodimerization activity
  • GO:0043047  — Molecular Function — single-stranded telomeric DNA binding
  • GO:0070491  — Molecular Function — repressing transcription factor binding
  • GO:1990841  — Molecular Function — promoter-specific chromatin binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >GRMZM2G095239_P02|Zea_mays|MYB_related|GRMZM2G095239_P02
    ATGGGGGCTCCAAAACAAAGGTGGACTTCTGAGGAAGAGGCTGCTCTTAGAGCTGGAATAGCAAGGCATGGAGTTGGAAAATGGCGCACAATATTGAAAGATCCAGAATTTAGTTCCACCTTATGCTACCGCTCAAATGTTGATCTCAAGGACAAGTGGCGAAACATGAATGTGATTGTCAGTACATCGAGTTCTCGTGACAAGGCGAAGTCTGCATTGAAGAGAATACGAACTATTCCCAAGAATAATGAGCACACCATGGCAATTACCAGAGTTACTTCTGATATTGATGATGAGATTGTTGACGAAAAGCCTATAGTATCATTGCCTAGTGAAGCAAAGAACACATCAAGTTCGAAGAAATCTCACAGGAGCAATATTGGCCACCTAGTGATTTTGATCACTTACTATCTGCAAAACTGA
Protein Sequence:
  • >GRMZM2G095239_P02|Zea_mays|MYB_related|GRMZM2G095239_P02
    MGAPKQRWTSEEEAALRAGIARHGVGKWRTILKDPEFSSTLCYRSNVDLKDKWRNMNVIVSTSSSRDKAKSALKRIRTIPKNNEHTMAITRVTSDIDDEIVDEKPIVSLPSEAKNTSSSKKSHRSNIGHLVILITYYLQN