Gene Details:

  • Gene ID: GRMZM2G000818_P02
  • Gene Name: Zm.98625
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Zea mays
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_021838682.1  — myb-related protein 308-like
  • Swissprot:  P81393  — MYB08_ANTMA; Myb-related protein 308
  • Swissprot:  Q9SZP1  — MYB4_ARATH; Transcription repressor MYB4
  • TrEMBL:  A0A0K9RMB2  — A0A0K9RMB2_SPIOL; Uncharacterized protein
  • STRING:  GRMZM2G000818_P01  — (Zea mays)
  • STRING:  XP_004289866.1  — (Fragaria vesca)

Gene Ontology:

  • GO:0090379  — Biological Process — secondary cell wall biogenesis involved in seed trichome differentiation
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >GRMZM2G000818_P02|Zea_mays|MYB_related|GRMZM2G000818_P02
    ATGGGGAGGTCGCCGTGCTGCGAGAAGGCGCACACGAACAAGGGCGCGTGGACCAAGGAGGAGGACGACCGTCTGGTGGCGTACATCAAGGCGCACGGCGAGGGGTGCTGGCGCTCCCTTCCCAAGGCCGCCGGACTTGTGCGCTGCGGCAAGAGCTGCCGCCTCCGGTGGATCAACTACCTGCGGCCCGACCTCAAGCGCGGCAACTTCACGGAGGAGGAGGACGAGCTCATCATCAAGCTCCACAGCCTACTCGGCAACAAGTAG
Protein Sequence:
  • >GRMZM2G000818_P02|Zea_mays|MYB_related|GRMZM2G000818_P02
    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLVRCGKSCRLRWINYLRPDLKRGNFTEEEDELIIKLHSLLGNK