Gene Details:

  • Gene ID: Gorai.002G083400.1
  • Gene Name: B456_002G083400, LOC105780295
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Gossypium raimondii
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_012459994.1  — PREDICTED: MYB-like transcription factor ETC1
  • Refseq:  XP_016715381.1  — PREDICTED: MYB-like transcription factor ETC1
  • Swissprot:  Q9LNI5  — ETC1_ARATH; MYB-like transcription factor ETC1
  • TrEMBL:  A0A0D2Q2P7  — A0A0D2Q2P7_GOSRA; Uncharacterized protein
  • TrEMBL:  A0A1U8LLA3  — A0A1U8LLA3_GOSHI; MYB-like transcription factor ETC1
  • TrEMBL:  A0A2P5QD32  — A0A2P5QD32_GOSBA; Uncharacterized protein
  • STRING:  Gorai.002G083400.1  — (Gossypium raimondii)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Gorai.002G083400.1|Gossypium_raimondii|MYB_related|Gorai.002G083400.1
    ATGGCTGAATCTGAATATTCTTCGAGTGAAAATGCATCTATGGACTCCGACTCCATAGAGGATCAAAGTAAACAAGATTTGGAACTTCAATTCTCAGAAGATGAGGAAACACTAGTAATCAGGATGTTTAATTTAGTTGGAGAAAGGTGGGGTTTGATCGCTGGGAGAATCCCTGGAAGAACAGCCGAGGAGATTGAGAAATATTGGAACACAAGATACTCAACAAGCCAGTGA
Protein Sequence:
  • >Gorai.002G083400.1|Gossypium_raimondii|MYB_related|Gorai.002G083400.1
    MAESEYSSSENASMDSDSIEDQSKQDLELQFSEDEETLVIRMFNLVGERWGLIAGRIPGRTAEEIEKYWNTRYSTSQ*