Gene Details:

  • Gene ID: Eucgr.D02099.2.p
  • Gene Name: EUGRSUZ_D02099
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Eucalyptus grandis
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_010053502.1  — PREDICTED: transcription factor MYB114
  • Swissprot:  Q9LTF7  — MYB82_ARATH; Transcription factor MYB82
  • TrEMBL:  A0A059CHZ8  — A0A059CHZ8_EUCGR; Uncharacterized protein
  • STRING:  XP_010053502.1  — (Eucalyptus grandis)

Gene Ontology:

  • GO:0009957  — Biological Process — epidermal cell fate specification
  • GO:0010090  — Biological Process — trichome morphogenesis
  • GO:0045892  — Biological Process — negative regulation of transcription, DNA-templated
  • GO:0045893  — Biological Process — positive regulation of transcription, DNA-templated
  • GO:0048481  — Biological Process — plant ovule development
  • GO:0048629  — Biological Process — trichome patterning
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0043565  — Molecular Function — sequence-specific DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Eucgr.D02099.2.p|Eucalyptus_grandis|MYB_related|Eucgr.D02099.2.p
    ATGACGGGCTTCTGTTCTGCTTTTTTTTTTTCAGGTCTGAACAGATGTGGGAAGAGCTGTAGACTGAGATGGTTGAATTATCTCAGACCCAATATCAAGAGAGGCAACATATCAGATGAAGAAGAAGACTTGATACTTAGGCTTCACAGGCTGCTTGGCAACAGGTGGTCGTTGATTGCTGGGAGACTTCCAGGAAGAACTGACAATGAAATCAAGAACTACTGGAATTCTCATTTGAGCAAGAAAATAAATCAAAGGCAAGAAGTTTCTACGGCACAGGAGACCACCTCGCAGCTCAGAACAAGGGTAGCGGCACCCATGGAGGAAGAGGGTGCTAACATCGTGGGGAGCTCGGAGCCCACTTTTGATGTGAACGAGTTTTTTGACTTCTCCACCGAAGGATCCTATGGCCTTGAGTGGGTTAATAAGTTCCTCGAGCTCGACGAGGATCGATGTCTCACCGAGAAGAGGTGA
Protein Sequence:
  • >Eucgr.D02099.2.p|Eucalyptus_grandis|MYB_related|Eucgr.D02099.2.p
    MTGFCSAFFFSGLNRCGKSCRLRWLNYLRPNIKRGNISDEEEDLILRLHRLLGNRWSLIAGRLPGRTDNEIKNYWNSHLSKKINQRQEVSTAQETTSQLRTRVAAPMEEEGANIVGSSEPTFDVNEFFDFSTEGSYGLEWVNKFLELDEDRCLTEKR*