Gene Details:

  • Gene ID: EPS74147.1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Genlisea aurea
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_011092800.1  — transcription factor RADIALIS-like isoform X1
  • Swissprot:  Q58FS3  — RAD_ANTMA; Transcription factor RADIALIS
  • TrEMBL:  S8EN20  — S8EN20_9LAMI; Uncharacterized protein (Fragment)
  • STRING:  XP_002509490.1  — (Ricinus communis)

Gene Ontology:

  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >EPS74147.1|Genlisea_aurea|MYB_related|EPS74147.1
    TGGACGGCGAAGGAGAACAAGGCGTTCGAGATAGCCCTCGCCGTGTTCGACAAGGACACGCCGGAGAGGTGGGCCGACGTCGCGAGGGCGATCGGAGGAAGGACGCCGGAGGAAGTCAAGAGACATTACGACGATCTCGTCCACGACGTCAGGTGCATCGAGAGCGGGAAAGTTCCCTTTCCCAAATACGTAACCACA
Protein Sequence:
  • >EPS74147.1|Genlisea_aurea|MYB_related|EPS74147.1
    WTAKENKAFEIALAVFDKDTPERWADVARAIGGRTPEEVKRHYDDLVHDVRCIESGKVPFPKYVTT