Gene Details:

  • Gene ID: EPS62609.1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Genlisea aurea
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_006601240.2  — transcription factor MYBS3, partial
  • Swissprot:  B8BI93  — MYBS2_ORYSI; Transcription factor MYBS2
  • Swissprot:  Q7XC51  — MYBS2_ORYSJ; Transcription factor MYBS2
  • TrEMBL:  S8C745  — S8C745_9LAMI; Uncharacterized protein (Fragment)
  • STRING:  Traes_1AL_F7D2C31DB.1  — (Triticum aestivum)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >EPS62609.1|Genlisea_aurea|MYB_related|EPS62609.1
    GGGATGCCATGGACGGAGGAAGAGCACAAGAAATTCTTAGAAGGTCTGGATAAGCTCGGAAGAGGAAATTGGAAAGGGATATCGAAGATATTCGTGAAAACAAGAAGTTCCACCCAAGTTGCTAGTCATGCACAAAAATACTTCCTTCGTAAATCTTCCATGGATAAGAGGAAGAGAAGAAATAGTGTTTTTGATGTTAGAATAGTAAGTGCCTTCTCA
Protein Sequence:
  • >EPS62609.1|Genlisea_aurea|MYB_related|EPS62609.1
    GMPWTEEEHKKFLEGLDKLGRGNWKGISKIFVKTRSSTQVASHAQKYFLRKSSMDKRKRRNSVFDVRIVSAFS