Gene Details:

  • Gene ID: EPS60416.1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Genlisea aurea
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_011086441.1  — transcription factor MYB1R1
  • Swissprot:  Q9LVS0  — KUA1_ARATH; Transcription factor KUA1
  • TrEMBL:  S8C7T2  — S8C7T2_9LAMI; Uncharacterized protein (Fragment)
  • STRING:  Migut.L01371.1.p  — (Erythranthe guttata)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0009651  — Biological Process — response to salt stress
  • GO:0009723  — Biological Process — response to ethylene
  • GO:0009733  — Biological Process — response to auxin
  • GO:0009737  — Biological Process — response to abscisic acid
  • GO:0009739  — Biological Process — response to gibberellin
  • GO:0009751  — Biological Process — response to salicylic acid
  • GO:0009753  — Biological Process — response to jasmonic acid
  • GO:0031540  — Biological Process — regulation of anthocyanin biosynthetic process
  • GO:0046686  — Biological Process — response to cadmium ion
  • GO:0080167  — Biological Process — response to karrikin
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding
  • GO:0003682  — Molecular Function — chromatin binding
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >EPS60416.1|Genlisea_aurea|MYB_related|EPS60416.1
    GGCGAGAAAGGCTTCATGTTGTTCGGAGTTAGGGTTATGACGGAGGGATCGCTCAGGAAGAGCGCTAGTATGGACAACCTGGCTCTGTTCGATCTGCAACCGCGCGAATCGAATCCGGATGCTGCTTCCGCTGCCGGTTATGCCTCCGACGACGTCGTTCATCTCTCTGCGAGAAGCCGAGACCGGAAGAGAGGAGTCCCCTGGAGCGAAGAGGAGCATCTGATGTTCCTGCTAGGGCTGCAGAAGGTCGGTAAAGGAGATTGGAGAGGAATTTCTCGAAACTACGTGAAGACAAGAACGCCTACTCAAGTAGCCAGTCATGCTCAGAAGTACTTCCTTCGCCGGAACAATCACAATAGGCGCCGCCGGAGATCCAGCCTCTTCGACATCACAACCGAGACGGTTGTGGGTTCTACAGGTGAGGAGCAGATG
Protein Sequence:
  • >EPS60416.1|Genlisea_aurea|MYB_related|EPS60416.1
    GEKGFMLFGVRVMTEGSLRKSASMDNLALFDLQPRESNPDAASAAGYASDDVVHLSARSRDRKRGVPWSEEEHLMFLLGLQKVGKGDWRGISRNYVKTRTPTQVASHAQKYFLRRNNHNRRRRRSSLFDITTETVVGSTGEEQM