Gene Details:

  • Gene ID: EMT16392
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Aegilops tauschii
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_020176382.1  — protein RADIALIS-like 5
  • Swissprot:  Q6NNN0  — RADL3_ARATH; Protein RADIALIS-like 3
  • TrEMBL:  A0A452ZY69  — A0A452ZY69_AEGTS; Uncharacterized protein
  • STRING:  EMT16392  — (Aegilops tauschii)
  • STRING:  Traes_1DL_F6047634A.1  — (Triticum aestivum)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >EMT16392|Aegilops_tauschii|MYB_related|EMT16392
    ATGTCCTCACCGAGCTCGGACTCAGAGTGGAGCAAGAAGGAGAACAAGATGTTCGAGGAGGCGCTCGCCTACTACGGCGTGGGCGCCCCCAACCTCTGGGAGAAGGTGGCCAGCGCCATGGGGGGCACCAAGTCCGCCGAGGAGGTGCGCCGCCACTTCCAGTTCCTCGTTGACGACGTCAAGAACATCGAGCACGGACGCATCCCCTTCCCCAAGTACAAGACCCAGGGCTTCTGGACCTAA
Protein Sequence:
  • >EMT16392|Aegilops_tauschii|MYB_related|EMT16392
    MSSPSSDSEWSKKENKMFEEALAYYGVGAPNLWEKVASAMGGTKSAEEVRRHFQFLVDDVKNIEHGRIPFPKYKTQGFWT