Gene Details:

  • Gene ID: EcS704717.10
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Eucalyptus camaldulensis
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_018717996.1  — PREDICTED: transcriptional activator Myb-like
  • Swissprot:  Q9LVW4  — MY118_ARATH; Transcription factor MYB118
  • TrEMBL:  A0A2G9HVJ7  — A0A2G9HVJ7_9LAMI; Transcription factor, Myb superfamily
  • STRING:  XP_010030743.1  — (Eucalyptus grandis)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >EcS704717.10|Eucalyptus_camaldulensis|MYB_related|EcS704717.10
    GCGCTTAATGATGTTGGTTGAGACTCGTGGAATGAAAAGGTGGTCTCAGATTGCTCAAATGATGAAGGGGAGAGTCGGAAAACAGTGCAGGGAGAGATGGCATAACCATTTGAGGCCTGATATCAAGGTTTTTCCCCTTTTTTTTTCCTTTAAATTTATCTTGCCCATAATTTGCTCCATCTTTAGACTCCTTCCTCCATTGTACCTTCCATTATATGAATTTACATCGACCGCCATACTCATT
Protein Sequence:
  • >EcS704717.10|Eucalyptus_camaldulensis|MYB_related|EcS704717.10
    RLMMLVETRGMKRWSQIAQMMKGRVGKQCRERWHNHLRPDIKVFPLFFSFKFILPIICSIFRLLPPLYLPLYEFTSTAILI