Gene Details:

  • Gene ID: EcS587627.10
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Eucalyptus camaldulensis
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_010066271.1  — PREDICTED: myb-related protein 308
  • Swissprot:  P81393  — MYB08_ANTMA; Myb-related protein 308
  • TrEMBL:  A0A2G9FVQ9  — A0A2G9FVQ9_9LAMI; Uncharacterized protein
  • TrEMBL:  A0A2H5MW44  — A0A2H5MW44_CITUN; Uncharacterized protein
  • STRING:  XP_010066271.1  — (Eucalyptus grandis)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >EcS587627.10|Eucalyptus_camaldulensis|MYB_related|EcS587627.10
    ATGGGAAGGTCTCCTTGCTGCGAGAAGGCTCACACAAACAAGGGCGCATGGACCAAGGAGGAGGACGACAAGCTCATTGCCTACATAAGAGCGCACGGCGAGGGTTGCAGGCGGTCGCTCCCGAAGGCC
Protein Sequence:
  • >EcS587627.10|Eucalyptus_camaldulensis|MYB_related|EcS587627.10
    MGRSPCCEKAHTNKGAWTKEEDDKLIAYIRAHGEGCRRSLPKA