Gene Details:

  • Gene ID: EcC055217.40
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Eucalyptus camaldulensis
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_010051089.1  — PREDICTED: MYB-like transcription factor ETC1 isoform X1
  • Swissprot:  Q9LNI5  — ETC1_ARATH; MYB-like transcription factor ETC1
  • TrEMBL:  A0A059DGB6  — A0A059DGB6_EUCGR; Uncharacterized protein
  • STRING:  XP_010051089.1  — (Eucalyptus grandis)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0005622  — Cellular Component — intracellular
  • GO:0005515  — Molecular Function — protein binding
  • GO:0008270  — Molecular Function — zinc ion binding
  • GO:0008289  — Molecular Function — lipid binding
  • GO:0009055  — Molecular Function — electron carrier activity
  • GO:0043565  — Molecular Function — sequence-specific DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >EcC055217.40|Eucalyptus_camaldulensis|MYB_related|EcC055217.40
    ATGTCTCGCCTGGACCATTCCTCTGATGATTCGTATGCGGACTCTAGAGCAGAGGATGTCAGTCAAGATTCTAAGCTGGAATTCTCGGAAGATGAGGAGACGCTCATAACTAGAATGTTCAAGCTAGTTGGCGAGAGGTGGTCGCTAATTGCCGGGAGAATTCCAGGGAGAACGGCGGAGGAAATCGAGAAGTTCTGGACTTCAAGATACTCGACCAGCGAAGACTGA
Protein Sequence:
  • >EcC055217.40|Eucalyptus_camaldulensis|MYB_related|EcC055217.40
    MSRLDHSSDDSYADSRAEDVSQDSKLEFSEDEETLITRMFKLVGERWSLIAGRIPGRTAEEIEKFWTSRYSTSED