Gene Details:

  • Gene ID: EcC055147.80
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Eucalyptus camaldulensis
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_010060952.1  — PREDICTED: protein RADIALIS-like 3
  • Swissprot:  Q1A173  — RADL6_ARATH; Protein RADIALIS-like 6
  • TrEMBL:  A0A059BP08  — A0A059BP08_EUCGR; Uncharacterized protein
  • STRING:  XP_010060952.1  — (Eucalyptus grandis)

Gene Ontology:

  • GO:0006284  — Biological Process — base-excision repair
  • GO:0006366  — Biological Process — transcription from RNA polymerase II promoter
  • GO:0042545  — Biological Process — cell wall modification
  • GO:0055085  — Biological Process — transmembrane transport
  • GO:0005618  — Cellular Component — cell wall
  • GO:0005665  — Cellular Component — DNA-directed RNA polymerase II, core complex
  • GO:0016021  — Cellular Component — integral component of membrane
  • GO:0003677  — Molecular Function — DNA binding
  • GO:0003899  — Molecular Function — DNA-directed RNA polymerase activity
  • GO:0005515  — Molecular Function — protein binding
  • GO:0022891  — Molecular Function — substrate-specific transmembrane transporter activity
  • GO:0030599  — Molecular Function — pectinesterase activity

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >EcC055147.80|Eucalyptus_camaldulensis|MYB_related|EcC055147.80
    ATGAGTTCGGGTTCGACATGGACGCCGAAGCAAAACAAGCTGTTTGAGAACGCGCTGGCGATATACGACAGGGATGCCCCCGACCGCTGGCAGAATCTGGCAAGAGCAGTCGGCGGAAACAAGAGCGTGGAGGACGTGAAGAGGCACTACGAGATGCTCGTTGAAGATGTGAACCAGATCGAGGCTGGGCAGGTCCCCTTGCCGAATTACCGAAAACTCGCAGCACCAAACAGCAAGGGGTGCAGTTCCTTCATGGACGAAGAGCAAAGGTATGTACAATGA
Protein Sequence:
  • >EcC055147.80|Eucalyptus_camaldulensis|MYB_related|EcC055147.80
    MSSGSTWTPKQNKLFENALAIYDRDAPDRWQNLARAVGGNKSVEDVKRHYEMLVEDVNQIEAGQVPLPNYRKLAAPNSKGCSSFMDEEQRYVQ