Gene Details:

  • Gene ID: EcC054802.310
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Eucalyptus camaldulensis
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_010055038.1  — PREDICTED: transcription factor CPC isoform X2
  • Swissprot:  Q8GV05  — TRY_ARATH; Transcription factor TRY
  • TrEMBL:  A0A059BZI7  — A0A059BZI7_EUCGR; Uncharacterized protein
  • STRING:  XP_010055037.1  — (Eucalyptus grandis)

Gene Ontology:

  • GO:0005975  — Biological Process — carbohydrate metabolic process
  • GO:0006032  — Biological Process — chitin catabolic process
  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0006412  — Biological Process — translation
  • GO:0006887  — Biological Process — exocytosis
  • GO:0007020  — Biological Process — microtubule nucleation
  • GO:0031122  — Biological Process — cytoplasmic microtubule organization
  • GO:0048278  — Biological Process — vesicle docking
  • GO:0000930  — Cellular Component — gamma-tubulin complex
  • GO:0005840  — Cellular Component — ribosome
  • GO:0032040  — Cellular Component — small-subunit processome
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0003735  — Molecular Function — structural constituent of ribosome
  • GO:0003924  — Molecular Function — GTPase activity
  • GO:0004568  — Molecular Function — chitinase activity
  • GO:0005515  — Molecular Function — protein binding
  • GO:0016853  — Molecular Function — isomerase activity
  • GO:0030246  — Molecular Function — carbohydrate binding
  • GO:0043565  — Molecular Function — sequence-specific DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >EcC054802.310|Eucalyptus_camaldulensis|MYB_related|EcC054802.310
    ATGGATAAACAACGCCGCCATAAGCAAGCCAGGACCAGCAGTTGTTGCTCCGACGAGGTGAGCAGCATTGAGTGGGAGTTCATAAACATGTCAGAGCAAGAAGAAGACCTTATTTACAGAATGTACAAGCTCGTTGGCGACAGGTGGGCGTTGATTGCGGGTCGGATTCCCGGCCGGAAGGCTGAGGAAATTGAGAGATTTTGGATCATGAGACATGGAGAGGTTTTTGCTGAGAGAAGGAGACAGCTGAGAAGACACAAGTCCTGA
Protein Sequence:
  • >EcC054802.310|Eucalyptus_camaldulensis|MYB_related|EcC054802.310
    MDKQRRHKQARTSSCCSDEVSSIEWEFINMSEQEEDLIYRMYKLVGDRWALIAGRIPGRKAEEIERFWIMRHGEVFAERRRQLRRHKS