Gene Details:

  • Gene ID: EcC054688.60
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Eucalyptus camaldulensis
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_010035221.1  — PREDICTED: MYB-like transcription factor ETC3
  • Swissprot:  Q8GV05  — TRY_ARATH; Transcription factor TRY
  • TrEMBL:  A0A058ZXN0  — A0A058ZXN0_EUCGR; Uncharacterized protein
  • STRING:  XP_010035221.1  — (Eucalyptus grandis)

Gene Ontology:

  • GO:0005992  — Biological Process — trehalose biosynthetic process
  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0006412  — Biological Process — translation
  • GO:0006468  — Biological Process — protein phosphorylation
  • GO:0009396  — Biological Process — folic acid-containing compound biosynthetic process
  • GO:0055085  — Biological Process — transmembrane transport
  • GO:0005840  — Cellular Component — ribosome
  • GO:0016021  — Cellular Component — integral component of membrane
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0003735  — Molecular Function — structural constituent of ribosome
  • GO:0004326  — Molecular Function — tetrahydrofolylpolyglutamate synthase activity
  • GO:0004672  — Molecular Function — protein kinase activity
  • GO:0005515  — Molecular Function — protein binding
  • GO:0005524  — Molecular Function — ATP binding
  • GO:0019843  — Molecular Function — rRNA binding
  • GO:0022857  — Molecular Function — transmembrane transporter activity
  • GO:0030247  — Molecular Function — polysaccharide binding
  • GO:0043565  — Molecular Function — sequence-specific DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >EcC054688.60|Eucalyptus_camaldulensis|MYB_related|EcC054688.60
    ATGGAAGCTCCGGGAAAGAGTCATCGAAGACAAGCCAGAATCGCCAGACCTTCTGATTCAGAAGAGGTCAGCAGTACAGAGTGGGAGGACATAGACATGACCGAGCAAGAGGAGGACCTGATTCACAGAATGCATAGACTCGTCGGCGAAAAGTGGGACTTGATAGCCGGGCGGATTCCGGGACGGAGCGCGGCAGAGATCGAGAGGTTCTGGATCATGAAGCACCGCAAGGGGTTTGCCGAGAGAAGAAGAGAGCGCAAGAAAGCAAAACCCGGGACATTTATCAAG
Protein Sequence:
  • >EcC054688.60|Eucalyptus_camaldulensis|MYB_related|EcC054688.60
    MEAPGKSHRRQARIARPSDSEEVSSTEWEDIDMTEQEEDLIHRMHRLVGEKWDLIAGRIPGRSAAEIERFWIMKHRKGFAERRRERKKAKPGTFIK