Gene Details:
- Gene ID: EcC054688.60
- Gene Family: MYB_related Family
- Description: MYB_related Family protein
- Species: Eucalyptus camaldulensis
- Source: MYB_related family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:4.10.60.10
- PROSITE profile: PS51294
- SuperFamily: SSF46689
- TIGRFAMs: TIGR01557
- SMART: SM00717
- Gene3D: G3DSA:1.10.10.60
- Pfam: PF00249
- InterPro: IPR001878 IPR017930 IPR009057 IPR006447 IPR001005
Annotation Proteins:
- Refseq: XP_010035221.1 — PREDICTED: MYB-like transcription factor ETC3
- Swissprot: Q8GV05 — TRY_ARATH; Transcription factor TRY
- TrEMBL: A0A058ZXN0 — A0A058ZXN0_EUCGR; Uncharacterized protein
- STRING: XP_010035221.1 — (Eucalyptus grandis)
Gene Ontology:
- GO:0005992 — Biological Process — trehalose biosynthetic process
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0006412 — Biological Process — translation
- GO:0006468 — Biological Process — protein phosphorylation
- GO:0009396 — Biological Process — folic acid-containing compound biosynthetic process
- GO:0055085 — Biological Process — transmembrane transport
- GO:0005840 — Cellular Component — ribosome
- GO:0016021 — Cellular Component — integral component of membrane
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0003735 — Molecular Function — structural constituent of ribosome
- GO:0004326 — Molecular Function — tetrahydrofolylpolyglutamate synthase activity
- GO:0004672 — Molecular Function — protein kinase activity
- GO:0005515 — Molecular Function — protein binding
- GO:0005524 — Molecular Function — ATP binding
- GO:0019843 — Molecular Function — rRNA binding
- GO:0022857 — Molecular Function — transmembrane transporter activity
- GO:0030247 — Molecular Function — polysaccharide binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction:
- A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.
Literature:
- A novel leaf-specific myb-related protein with a single binding repeat. DOI: 10.1016/s0378-1119(96)00521-5 ; PMID: 8996094
Sequences:
CDS Sequence:
- >EcC054688.60|Eucalyptus_camaldulensis|MYB_related|EcC054688.60
ATGGAAGCTCCGGGAAAGAGTCATCGAAGACAAGCCAGAATCGCCAGACCTTCTGATTCAGAAGAGGTCAGCAGTACAGAGTGGGAGGACATAGACATGACCGAGCAAGAGGAGGACCTGATTCACAGAATGCATAGACTCGTCGGCGAAAAGTGGGACTTGATAGCCGGGCGGATTCCGGGACGGAGCGCGGCAGAGATCGAGAGGTTCTGGATCATGAAGCACCGCAAGGGGTTTGCCGAGAGAAGAAGAGAGCGCAAGAAAGCAAAACCCGGGACATTTATCAAG
Protein Sequence:
- >EcC054688.60|Eucalyptus_camaldulensis|MYB_related|EcC054688.60
MEAPGKSHRRQARIARPSDSEEVSSTEWEDIDMTEQEEDLIHRMHRLVGEKWDLIAGRIPGRSAAEIERFWIMKHRKGFAERRRERKKAKPGTFIK