Gene Details:

  • Gene ID: EcC054120.10
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Eucalyptus camaldulensis
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_003056512.1  — predicted protein, partial
  • Refseq:  XP_016516169.1  — PREDICTED: cell division cycle 5-like protein, partial
  • Refseq:  XP_019232628.1  — PREDICTED: cell division cycle 5-like protein
  • Swissprot:  P92948  — CDC5L_ARATH; Cell division cycle 5-like protein
  • TrEMBL:  A0A1R3HNX5  — A0A1R3HNX5_COCAP; Uncharacterized protein (Fragment)
  • TrEMBL:  A0A392TLI1  — A0A392TLI1_9FABA; Cell division cycle 5-like protein (Fragment)
  • STRING:  XP_003056512.1  — (Micromonas pusilla)
  • STRING:  Lus10043451  — (Linum usitatissimum)
  • STRING:  XP_009631530.1  — (Nicotiana tomentosiformis)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >EcC054120.10|Eucalyptus_camaldulensis|MYB_related|EcC054120.10
    ATGAGGATTATGATCAAGGGAGGTGTTTGGAAGAACACCGAGGATGAGATCCTTAAGGCGGCGGTCATGAAGTATGGCAAGAATCAGTGGGCCCGCATCTCTTCCCTCCTCGTCCGTAAGTCCGCCAAGCAGTGCAAAGCCCGGTGGTACGAGTGGCTCGATCCCTCCATCAAGAAGACGGAATGGACACGAGAGGAGGACGAGAAGTTGCTGCATCTTGCCAAG
Protein Sequence:
  • >EcC054120.10|Eucalyptus_camaldulensis|MYB_related|EcC054120.10
    MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKTEWTREEDEKLLHLAK