Gene Details:

  • Gene ID: Do024356.1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Dichanthelium oligosanthes
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_025816197.1  — MYB-like transcription factor ETC3
  • Swissprot:  B3H4X8  — TCL2_ARATH; MYB-like transcription factor TCL2
  • TrEMBL:  A0A1E5V4A8  — A0A1E5V4A8_9POAL; Uncharacterized protein
  • STRING:  Pavir.J30777.1.p  — (Panicum virgatum)

Gene Ontology:

  • GO:0045892  — Biological Process — negative regulation of transcription, DNA-templated
  • GO:1900033  — Biological Process — negative regulation of trichome patterning
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Do024356.1|Dichanthelium_oligosanthes|MYB_related|Do024356.1
    ATGAAAAAAATTGCTCCACATTCCATTGGCGATCATAGGATTGGTGGCTGTAATATATTTCTACATGGTTTGGTACTATGTTCTTTTGCTTACTTTCCTGATCAATTATATACTTTCATGATCATTGCAGAAGCAAATAGCACTGCACATCATTTTGTTGACTTCACAGACGATGAGGAAGATCTTTTTTTCAGAATGCACAGGCTTGTGGGGAACAGGTGGGAGCTTATAGCAGGAAGAATTCCAGGAAGGACAGCAGAAGAAGTAGAGATGTTTTGGTCTAAAAAACACCAGGAAAAATGA
Protein Sequence:
  • >Do024356.1|Dichanthelium_oligosanthes|MYB_related|Do024356.1
    MKKIAPHSIGDHRIGGCNIFLHGLVLCSFAYFPDQLYTFMIIAEANSTAHHFVDFTDDEEDLFFRMHRLVGNRWELIAGRIPGRTAEEVEMFWSKKHQEK